|
Name : ureB (PSPA7_5588) Accession : YP_001350909.1 Strain : Pseudomonas aeruginosa PA7 Genome accession: NC_009656 Putative virulence/resistance : Virulence Product : urease subunit beta Function : - COG functional category : E : Amino acid transport and metabolism COG ID : COG0832 EC number : - Position : 5756793 - 5757098 bp Length : 306 bp Strand : + Note : ureases catalyze the hydrolysis of urea into ammonia and carbon dioxide; in Helicobacter pylori and Yersinia enterocolitica the ammonia released plays a key role in bacterial survival by neutralizing acids when colonizing the gastric mucosa; the holoenzym DNA sequence : ATGATCCCCGGTGAATACGACATCCAGCCCGGCGATATCGAACTCAACGCCGGCCGCCGCACCCTCGCCCTGAGCGTGGC GAACACCGGCGACCGGCCGATCCAGGTCGGCTCGCACTACCACTTCTTCGAGGTCAACGACGCCCTCGCCTTCGACCGTC CGGCCACCCGTGGCATGCGCCTGAACATCGCCGCCGGCACCGCGGTGCGCTTCGAACCGGGGCAGAGCCGCGAGGTGGAG CTGGTGGAGCTGGCCGGCGAGCGGCGGGTCTACGGCTTCGCCGGGCGGGTGATGGGCGACCTCTAG Protein sequence : MIPGEYDIQPGDIELNAGRRTLALSVANTGDRPIQVGSHYHFFEVNDALAFDRPATRGMRLNIAAGTAVRFEPGQSREVE LVELAGERRVYGFAGRVMGDL |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ureB | NP_286679.1 | urease subunit beta | Virulence | TAI | Protein | 2e-28 | 72 |
| ureB | NP_287087.1 | urease subunit beta | Not tested | TAI | Protein | 2e-28 | 72 |
| ureB | YP_005682175.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 2e-24 | 58 |
| ureB | YP_005684267.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 2e-24 | 58 |
| ureB | YP_005686359.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 2e-24 | 58 |
| ureB | YP_003784326.1 | urease subunit beta | Not tested | PiCp 7 | Protein | 3e-24 | 58 |
