Gene Information

Name : PSPA7_2348 (PSPA7_2348)
Accession : YP_001347715.1
Strain : Pseudomonas aeruginosa PA7
Genome accession: NC_009656
Putative virulence/resistance : Virulence
Product : putative two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2400997 - 2401683 bp
Length : 687 bp
Strand : -
Note : Annotation generated by automatically transferring the annotation from the manually curated GenBank accession AE004091; identified by match to protein family HMM PF00072; match to protein family HMM PF00486; match to protein family HMM TIGR01387

DNA sequence :
ATGAACATGAAACTGCTGATCGTCGAAGACGAACCACGTATCGGCCAGTACCTGCGCCAGGGGCTCGCCGAGTCCGGCTA
CGCCGTCGACCTGAGCGACGACGGCAACGAGGGCGAGCAATTGGCCCTGGGCGGCGACTATGACCTGCTGATCCTCGACG
TCATGCTGCCCGGCCGGGACGGCTGGCAGATCCTGCGCAGCGTGCGCGACGCCGGAATGACCGTGCCGGTGCTGTTCCTC
ACCGCCCGCGACGCCGTCGAGGACCGCGTGCGCGGCCTGGAACAGGGCGCCGACGATTACCTGGTGAAGCCCTTCGCCTT
CGTCGAGTTGCTCGCCCGCGTGCGCACCCTGCTGCGCCGTGGCAACCAGCAGTTGCAGGAGACCACCCTGCAACTGGCCG
ATCTCGAACTCGACCTGCTGCGTCGCCGGGTGCAGCGCCAGGGCAAGCGCATCGACCTGACCGCCAAGGAATTCGCCCTG
CTCGAACTGCTGTTGCGGCGCAGCGGCGAGGTGCTGCCCAAGTCGCTGATCGCCTCGCAGGTCTGGGACATGAACTTCGA
CAGCGACACCAACGTCATCGAGGTCGCCATCCGCCGCCTGCGCGCCAAGGTCGACGACGACTTCCCGCAGCGCCTGATCC
ATACCGTGCGCGGCATGGGCTACGTCCTCGAAGAACGCGACGAATGA

Protein sequence :
MNMKLLIVEDEPRIGQYLRQGLAESGYAVDLSDDGNEGEQLALGGDYDLLILDVMLPGRDGWQILRSVRDAGMTVPVLFL
TARDAVEDRVRGLEQGADDYLVKPFAFVELLARVRTLLRRGNQQLQETTLQLADLELDLLRRRVQRQGKRIDLTAKEFAL
LELLLRRSGEVLPKSLIASQVWDMNFDSDTNVIEVAIRRLRAKVDDDFPQRLIHTVRGMGYVLEERDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-53 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-52 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSPA7_2348 YP_001347715.1 putative two-component response regulator BAC0638 Protein 6e-61 72
PSPA7_2348 YP_001347715.1 putative two-component response regulator BAC0083 Protein 1e-66 71
PSPA7_2348 YP_001347715.1 putative two-component response regulator BAC0111 Protein 8e-64 64
PSPA7_2348 YP_001347715.1 putative two-component response regulator BAC0308 Protein 2e-61 63
PSPA7_2348 YP_001347715.1 putative two-component response regulator BAC0125 Protein 5e-58 59
PSPA7_2348 YP_001347715.1 putative two-component response regulator BAC0197 Protein 7e-58 59
PSPA7_2348 YP_001347715.1 putative two-component response regulator BAC0347 Protein 8e-56 58
PSPA7_2348 YP_001347715.1 putative two-component response regulator BAC0487 Protein 9e-27 43
PSPA7_2348 YP_001347715.1 putative two-component response regulator NC_002516.2.879194.p Protein 6e-25 41
PSPA7_2348 YP_001347715.1 putative two-component response regulator HE999704.1.gene1528. Protein 1e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSPA7_2348 YP_001347715.1 putative two-component response regulator VFG0596 Protein 3e-53 57
PSPA7_2348 YP_001347715.1 putative two-component response regulator VFG1390 Protein 2e-37 46
PSPA7_2348 YP_001347715.1 putative two-component response regulator VFG1389 Protein 3e-28 43
PSPA7_2348 YP_001347715.1 putative two-component response regulator VFG0473 Protein 4e-28 41