Gene Information

Name : cadR (PSPA7_1449)
Accession : YP_001346833.1
Strain : Pseudomonas aeruginosa PA7
Genome accession: NC_009656
Putative virulence/resistance : Resistance
Product : Cd(II)/Pb(II)-responsive transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1469423 - 1469893 bp
Length : 471 bp
Strand : +
Note : Annotation was generated automatically without manual curation; identified by match to protein family HMM PF00376; match to protein family HMM PF09278; match to protein family HMM TIGR02047

DNA sequence : 
ATGAAGATCGGTGAACTGGCGAAACGCACCGGCTGCCCGGTGGAAACCATCCGCTACTACGAGCGCGAGGGACTGTTGCC
CGAGCCGGGGCGCAGCGAAGGCAACTACCGGCAGTACACGCTGGCGCACGTCGAACGCCTGTCGTTCATCCGCCATTGCC
GTTCGCTGGACATGACCCAGGAGGAAATCCGCACCCTGCTGGCCTTGCGCGACCGCCCCGAGGCGGACTGCGGTACCGCC
AACCGGCTGATCGACGAGCACCTGCACCATGTCGAGGTGCGCATCGCCGAACTCCAGGCGCTGCGCGAGCAACTGCAGGA
CCTCGGCTCGCGCTGCACGGTCGCCGGCAACAGCGAGGCCTGCGGCATCCTCCGCGAACTGGAGCAGCCGGCGCCGCTAT
CGCCGATCGCCGATGACTGCGCCGGCGCCGGACACCTGCACGTGCCCGGGGTGCACAAGCGCCACGGCTGA

Protein sequence : 
MKIGELAKRTGCPVETIRYYEREGLLPEPGRSEGNYRQYTLAHVERLSFIRHCRSLDMTQEEIRTLLALRDRPEADCGTA
NRLIDEHLHHVEVRIAELQALREQLQDLGSRCTVAGNSEACGILRELEQPAPLSPIADDCAGAGHLHVPGVHKRHG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 1e-33 55
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 1e-28 49
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 9e-29 49
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 1e-28 49
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 9e-29 49
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 3e-28 48
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 2e-28 48
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 2e-28 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cadR YP_001346833.1 Cd(II)/Pb(II)-responsive transcriptional regulator BAC0058 Protein 5e-40 60
cadR YP_001346833.1 Cd(II)/Pb(II)-responsive transcriptional regulator BAC0301 Protein 4e-32 58
cadR YP_001346833.1 Cd(II)/Pb(II)-responsive transcriptional regulator BAC0462 Protein 1e-23 43