Name : merP1 (PSPA7_0113) Accession : YP_001345509.1 Strain : Pseudomonas aeruginosa PA7 Genome accession: NC_009656 Putative virulence/resistance : Resistance Product : mercuric transport periplasmic protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 121405 - 121680 bp Length : 276 bp Strand : - Note : Annotation was generated automatically without manual curation; identified by match to protein family HMM PF00403; match to protein family HMM TIGR02052 DNA sequence : ATGCGCAAACTGCTGATCGCCGTGCTTTTCGCCTTGCCCTTCGTGGCGCTGGCGGCTCCCCCGAAAACCGTCACGCTCGA CGTGCAGAACATGACGTGCGGACTCTGTCCGATCACGGTCAAGAAGTCGCTGGAGAAGGTGTCCGGCGTGAGTGACGTCC AGGTCAATTTCGACCAGAAGACGGCGACCGTCACCTACGATCCCGATAAGGCCCAGCCCGAGGCACTGACTGAGGCGACC GCGAACGCGGGATACCCCTCCACAGTGCAGAAGTGA Protein sequence : MRKLLIAVLFALPFVALAAPPKTVTLDVQNMTCGLCPITVKKSLEKVSGVSDVQVNFDQKTATVTYDPDKAQPEALTEAT ANAGYPSTVQK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 3e-15 | 61 |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 2e-15 | 61 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 2e-15 | 61 |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 2e-15 | 61 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 2e-15 | 61 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 2e-15 | 61 |
merP | AAN62179.1 | periplasmic mercuric ion binding protein MerP | Not tested | PAGI-2(C) | Protein | 3e-16 | 58 |
merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 2e-14 | 54 |
merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 3e-14 | 54 |
unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 6e-15 | 52 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
merP1 | YP_001345509.1 | mercuric transport periplasmic protein | BAC0678 | Protein | 4e-15 | 58 |
merP1 | YP_001345509.1 | mercuric transport periplasmic protein | BAC0231 | Protein | 2e-15 | 57 |
merP1 | YP_001345509.1 | mercuric transport periplasmic protein | BAC0679 | Protein | 1e-15 | 56 |
merP1 | YP_001345509.1 | mercuric transport periplasmic protein | BAC0675 | Protein | 5e-15 | 54 |
merP1 | YP_001345509.1 | mercuric transport periplasmic protein | BAC0674 | Protein | 3e-14 | 52 |