Gene Information

Name : merP1 (PSPA7_0113)
Accession : YP_001345509.1
Strain : Pseudomonas aeruginosa PA7
Genome accession: NC_009656
Putative virulence/resistance : Resistance
Product : mercuric transport periplasmic protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 121405 - 121680 bp
Length : 276 bp
Strand : -
Note : Annotation was generated automatically without manual curation; identified by match to protein family HMM PF00403; match to protein family HMM TIGR02052

DNA sequence :
ATGCGCAAACTGCTGATCGCCGTGCTTTTCGCCTTGCCCTTCGTGGCGCTGGCGGCTCCCCCGAAAACCGTCACGCTCGA
CGTGCAGAACATGACGTGCGGACTCTGTCCGATCACGGTCAAGAAGTCGCTGGAGAAGGTGTCCGGCGTGAGTGACGTCC
AGGTCAATTTCGACCAGAAGACGGCGACCGTCACCTACGATCCCGATAAGGCCCAGCCCGAGGCACTGACTGAGGCGACC
GCGAACGCGGGATACCCCTCCACAGTGCAGAAGTGA

Protein sequence :
MRKLLIAVLFALPFVALAAPPKTVTLDVQNMTCGLCPITVKKSLEKVSGVSDVQVNFDQKTATVTYDPDKAQPEALTEAT
ANAGYPSTVQK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-15 61
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-15 61
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-15 61
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-15 61
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 3e-15 61
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-15 61
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 3e-16 58
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 3e-14 54
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 2e-14 54
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 6e-15 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merP1 YP_001345509.1 mercuric transport periplasmic protein BAC0678 Protein 4e-15 58
merP1 YP_001345509.1 mercuric transport periplasmic protein BAC0231 Protein 2e-15 57
merP1 YP_001345509.1 mercuric transport periplasmic protein BAC0679 Protein 1e-15 56
merP1 YP_001345509.1 mercuric transport periplasmic protein BAC0675 Protein 5e-15 54
merP1 YP_001345509.1 mercuric transport periplasmic protein BAC0674 Protein 3e-14 52