Gene Information

Name : Mmwyl1_0627 (Mmwyl1_0627)
Accession : YP_001339496.1
Strain : Marinomonas sp. MWYL1
Genome accession: NC_009654
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 685494 - 685799 bp
Length : 306 bp
Strand : -
Note : PFAM: transposase IS3/IS911 family protein; KEGG: pau:PA14_51620 possible transposase

DNA sequence :
ATGACAAAACGTCGTGTATTTTCAGCAGAGTTTAAGCATGAAGCCGCCAGCTTAGTACTCGATCAAGGCTACAGTTTTAC
TGAGGCCTGCCAGTCCCTTGGCATTGGTGAGACAGCTCTACGACGCTGGGTTGGTCAGCTTAAAGATGAACGAGGTGGTG
TCACACCAAAAGCGAAAGCTTTGACACCAGAACAGCAGCGCATACAAGAGCTTGAAGCCAAAATTAGTCGATTAGAAAGG
GAAAAAGCCATTCTAAAAAAGGCTACAGCTCTCTTGATGTCGGACGACCTAGAACGTATGCGCTAA

Protein sequence :
MTKRRVFSAEFKHEAASLVLDQGYSFTEACQSLGIGETALRRWVGQLKDERGGVTPKAKALTPEQQRIQELEAKISRLER
EKAILKKATALLMSDDLERMR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-33 77
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-23 62
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-23 62
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-23 62
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-23 62
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-23 62
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-23 62
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-23 62
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-23 62
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-22 57
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-22 57
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-22 55
api80 CAF28554.1 putative transposase Not tested YAPI Protein 1e-18 53
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 4e-19 53
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 7e-23 53
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 5e-23 53
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-21 52
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-21 52
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-21 52
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-21 52
ORF SG13 AAN62235.1 conserved hypothetical protein Not tested PAGI-3(SG) Protein 3e-14 44
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 1e-16 44
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 6e-11 43
tnpA CAB61575.1 transposase A Not tested HPI Protein 4e-16 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mmwyl1_0627 YP_001339496.1 transposase IS3/IS911 family protein VFG1123 Protein 5e-24 62
Mmwyl1_0627 YP_001339496.1 transposase IS3/IS911 family protein VFG1485 Protein 6e-23 57
Mmwyl1_0627 YP_001339496.1 transposase IS3/IS911 family protein VFG1553 Protein 2e-19 53
Mmwyl1_0627 YP_001339496.1 transposase IS3/IS911 family protein VFG0784 Protein 5e-22 52
Mmwyl1_0627 YP_001339496.1 transposase IS3/IS911 family protein VFG1566 Protein 2e-11 43