Gene Information

Name : set5nm (NWMN_0392)
Accession : YP_001331426.1
Strain : Staphylococcus aureus Newman
Genome accession: NC_009641
Putative virulence/resistance : Virulence
Product : superantigen-like protein 5
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 440697 - 441401 bp
Length : 705 bp
Strand : +
Note : SSL5, SET3, SET10; bind P-selectin glycoprotein ligand-1 and inhibit P-selectin-mediated neutrophil rolling along the endothelium; these proteins share structural homology to known superantigens but do not exhibit any of the properties expected such as hi

DNA sequence :
ATGAAAATGACAGCAATTGCGAAAGCAAGTTTAGCATTAGGTATTTTAGCAACAGGAACAATAACGTCATTGCATCAAAC
TGTAAATGCGAGTGAACATAAAGCAAAATATGAAAATGTGACAAAAGATATCTTTGACTTAAGAGATTACTATAGTGGCG
CAAGTAAGGAACTTAAAAATGTTACTGGTTATCGTTATAGCAAAGGTGGCAAGCATTACCTTATCTTTGATAAAAATAGA
AAATTCACAAGAGTACAGATATTTGGTAAAGATATTGAAAGATTTAAAGCACGTAAAAATCCGGGATTAGACATATTTGT
TGTTAAAGAAGCGGAAAACCGTAATGGCACAGTGTTTTCATATGGTGGTGTCACTAAGAAAAATCAAGACGCTTATTATG
ATTATATAAACGCACCAAGATTTCAAATCAAGAGAGATGAAGGTGACGGTATTGCTACGTACGGTAGAGTACACTACATT
TATAAAGAAGAGATTTCACTTAAAGAACTCGACTTTAAATTGAGACAGTATTTAATTCAAAATTTTGATCTGTATAAAAA
GTTTCCTAAAGATAGTAAGATAAAAGTGATAATGAAAGATGGCGGCTATTATACGTTTGAACTTAATAAAAAATTACAAA
CAAATCGCATGAGTGACGTCATTGACGGTAGAAATATTGAAAAAATAGAAGCCAACATTAGATAA

Protein sequence :
MKMTAIAKASLALGILATGTITSLHQTVNASEHKAKYENVTKDIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKNR
KFTRVQIFGKDIERFKARKNPGLDIFVVKEAENRNGTVFSYGGVTKKNQDAYYDYINAPRFQIKRDEGDGIATYGRVHYI
YKEEISLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQTNRMSDVIDGRNIEKIEANIR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
set5nm YP_001331426.1 superantigen-like protein 5 Virulence vSa¥á Protein 4e-105 100
SAUSA300_0399 YP_493113.1 superantigen-like protein 5 Virulence vSa¥á Protein 4e-105 100
set10 NP_370949.1 superantigen-like protein 5 Virulence vSa¥á Protein 2e-104 99
set10 NP_373636.1 superantigen-like protein 5 Virulence vSa¥á Protein 2e-104 99
SAKOR_00409 YP_008490593.1 Exotoxin Virulence vSa¥á Protein 4e-104 99
set20 NP_645203.1 superantigen-like protein 5 Virulence vSa¥á Protein 8e-104 98
SAS0388 YP_042513.1 superantigen-like protein 5 Virulence vSa¥á Protein 8e-104 98
set3 YP_039879.1 superantigen-like protein 5 Virulence vSa¥á Protein 3e-92 88
SAMSHR1132_03750 YP_005324897.1 exotoxin 3 Virulence vSa¥á Protein 4e-93 85
SAS0396 YP_042522.1 superantigen-like protein Virulence vSa¥á Protein 4e-45 50
set26 NP_645211.1 superantigen-like protein Virulence vSa¥á Protein 4e-45 50
SAR0435 YP_039886.1 superantigen-like protein Virulence vSa¥á Protein 4e-45 50
SACOL0478 YP_185368.1 superantigen-like protein Virulence vSa¥á Protein 1e-37 48
set11nm YP_001331434.1 superantigen-like protein Virulence vSa¥á Protein 1e-37 48
SAUSA300_0407 YP_493121.1 superantigen-like protein Virulence vSa¥á Protein 1e-37 48
SAMSHR1132_03810 YP_005324902.1 exotoxin Virulence vSa¥á Protein 4e-41 48
set15 NP_370957.1 superantigen-like protein Virulence vSa¥á Protein 4e-42 47
set15 NP_373644.1 superantigen-like protein Virulence vSa¥á Protein 4e-42 47
SAKOR_00417 YP_008490601.1 Exotoxin Not tested vSa¥á Protein 2e-38 46
SAKOR_00404 YP_008490588.1 Exotoxin Virulence vSa¥á Protein 3e-43 45
SAMSHR1132_03720 YP_005324894.1 exotoxin Virulence vSa¥á Protein 1e-40 44
SAUSA300_0395 YP_493109.1 superantigen-like protein Virulence vSa¥á Protein 4e-42 43
SAR0422 YP_039874.1 superantigen-like protein Virulence vSa¥á Protein 5e-38 43
SACOL0468 YP_185358.1 superantigen-like protein Virulence vSa¥á Protein 4e-42 43
SAS0384 YP_042509.1 superantigen-like protein Virulence vSa¥á Protein 5e-39 43
set1nm YP_001331422.1 superantigen-like protein Virulence vSa¥á Protein 4e-42 43
set16 NP_645199.1 superantigen-like protein Virulence vSa¥á Protein 5e-39 43
set6 NP_370946.1 superantigen-like protein Virulence vSa¥á Protein 4e-41 42
set6 NP_373632.1 superantigen-like protein Virulence vSa¥á Protein 4e-41 42
set23 NP_645206.1 superantigen-like protein Virulence vSa¥á Protein 3e-31 42
SAS0391 YP_042516.2 superantigen-like protein Virulence vSa¥á Protein 3e-31 42
set8nm YP_001331429.2 superantigen-like protein Virulence vSa¥á Protein 2e-30 41
SAUSA300_0402 YP_493116.1 superantigen-like protein Virulence vSa¥á Protein 2e-30 41
set12 NP_370951.1 superantigen-like protein Virulence vSa¥á Protein 9e-31 41
set12 NP_373638.1 superantigen-like protein Virulence vSa¥á Protein 9e-31 41
SAKOR_00411 YP_008490595.1 Exotoxin Virulence vSa¥á Protein 1e-30 41