
|
Name : NWMN_1905 (NWMN_1905) Accession : YP_001332939.1 Strain : Staphylococcus aureus Newman Genome accession: NC_009641 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 2117272 - 2117523 bp Length : 252 bp Strand : - Note : similar to SAR2074 of Staphylococcus aureus subsp. aureus MRSA252 [Bacteriophage phiNM3] DNA sequence : ATGAATAATCGCGAACAAATTGAACAATCAGTTATAAGTGCTAGTGCGTATAACGGTAATGACACAGAGGGATTACTAAA AGAGATTGAGGACGTTTATAAGAAAGCGCAAGCGTTTGATGAAATACTTGAGGGAATGACAAATGCTATTCAACATTCAG TTAAAGAAGGTGTTGAACTTGATGAAGCAGTAGGGATTATGGCAGGTCAAGTTGTCTATAAATATGAGGAGGAACAGGAA AATGAGCATTAG Protein sequence : MNNREQIEQSVISASAYNGNDTEGLLKEIEDVYKKAQAFDEILEGMTNAIQHSVKEGVELDEAVGIMAGQVVYKYEEEQE NEH |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SAOV_0305 | YP_005735822.1 | hypothetical protein | Not tested | ¥ÕSa1 | Protein | 1e-30 | 98 |
| SAOV_1942c | YP_005737386.1 | hypothetical phage-related protein | Not tested | ¥ÕSa3 | Protein | 8e-30 | 94 |
| SAOV_1091 | YP_005736586.1 | hypothetical protein | Not tested | ¥ÕSa2 | Protein | 8e-30 | 94 |
| MW1419 | NP_646236.1 | hypothetical protein | Not tested | ¥ÕSa2 | Protein | 6e-30 | 94 |
| SA1785 | NP_375084.1 | hypothetical protein | Not tested | ¥ÕSa3 | Protein | 3e-29 | 93 |
| SAV0875 | NP_371399.1 | phi PVL ORF 52-like protein | Not tested | ¥ÕSa1 | Protein | 9e-30 | 93 |
| SAKOR_01957 | YP_008492145.1 | Phage protein | Not tested | ¥ÕSa3 | Protein | 8e-25 | 86 |
| SAUSA300_1418 | YP_494115.1 | phiSLT ORF 82-like protein | Not tested | ¥ÕSa2 | Protein | 2e-27 | 85 |