Gene Information

Name : Smed_0124 (Smed_0124)
Accession : YP_001325819.1
Strain : Sinorhizobium medicae WSM419
Genome accession: NC_009636
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 138486 - 139169 bp
Length : 684 bp
Strand : +
Note : TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: sme:SMc02140 phosphate regulon transcriptional regulatory protein

DNA sequence :
ATGTTGCCGAAGATTGCCGTAGTCGAAGACGAGGAAGCCCTGAGCGTTCTCCTGCGCTATAATCTCGAGGCGGAAGGCTT
CGAGGTTGACACTATCCTTCGCGGCGACGAGGCGGAAATCCGCCTGCAGGAGCGCCTGCCCGACCTTCTCATTCTCGACT
GGATGCTGCCCGGGGTTTCCGGCATCGAGCTCTGCCGCAGGCTGCGCCAGCGGCCCGAGACGGAGCGCCTTCCGATCATC
ATGCTGACGGCGCGCGGCGAGGAAAGCGAGCGCGTGCGGGGCCTTGCGACCGGCGCCGACGACTATGTCGTCAAACCGTT
CTCGACGCCGGAACTGATGGCGAGGGTCAAGGCGATGCTCAGGCGAGCCAAGCCCGAGGTCCTGTCGACGCTCCTGCGCT
GCGGCGATATCGAGCTCGACCGGGAGACGCACCGGGTGCATCGCCGCAGCCGCGAAGTGCGCCTCGGCCCGACGGAGTTC
CGGCTGCTGGAATTCCTCATGTCCTCTCCGGGACGTGTCTTCTCCCGTTCCCAGCTTCTGGACGGTGTCTGGGGGCACGA
CATCTATGTCGACGAACGGACCGTCGACGTCCATGTCGGGCGTCTGCGCAAGGCGCTGAACTTCTCCAATATGCCGGATG
TCATCCGCACCGTGCGCGGCGCGGGCTACTCGTTGGAAAGCTGA

Protein sequence :
MLPKIAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEIRLQERLPDLLILDWMLPGVSGIELCRRLRQRPETERLPII
MLTARGEESERVRGLATGADDYVVKPFSTPELMARVKAMLRRAKPEVLSTLLRCGDIELDRETHRVHRRSREVRLGPTEF
RLLEFLMSSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLRKALNFSNMPDVIRTVRGAGYSLES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-35 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-34 43
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 6e-27 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 6e-27 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 6e-27 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 6e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Smed_0124 YP_001325819.1 two component transcriptional regulator HE999704.1.gene2815. Protein 4e-40 44
Smed_0124 YP_001325819.1 two component transcriptional regulator AE000516.2.gene3505. Protein 9e-34 44
Smed_0124 YP_001325819.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-41 43
Smed_0124 YP_001325819.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-41 43
Smed_0124 YP_001325819.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-41 43
Smed_0124 YP_001325819.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-41 43
Smed_0124 YP_001325819.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-41 43
Smed_0124 YP_001325819.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-41 43
Smed_0124 YP_001325819.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-41 43
Smed_0124 YP_001325819.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-41 43
Smed_0124 YP_001325819.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-41 43
Smed_0124 YP_001325819.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-41 43
Smed_0124 YP_001325819.1 two component transcriptional regulator CP001918.1.gene3444. Protein 1e-32 42
Smed_0124 YP_001325819.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-35 41
Smed_0124 YP_001325819.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-35 41
Smed_0124 YP_001325819.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 1e-34 41
Smed_0124 YP_001325819.1 two component transcriptional regulator NC_012469.1.7685629. Protein 4e-36 41
Smed_0124 YP_001325819.1 two component transcriptional regulator NC_002516.2.879194.p Protein 8e-27 41
Smed_0124 YP_001325819.1 two component transcriptional regulator BAC0039 Protein 6e-32 41
Smed_0124 YP_001325819.1 two component transcriptional regulator CP000034.1.gene2186. Protein 6e-32 41
Smed_0124 YP_001325819.1 two component transcriptional regulator NC_002695.1.916589.p Protein 5e-32 41
Smed_0124 YP_001325819.1 two component transcriptional regulator CP000647.1.gene2531. Protein 7e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Smed_0124 YP_001325819.1 two component transcriptional regulator VFG1390 Protein 3e-36 45
Smed_0124 YP_001325819.1 two component transcriptional regulator VFG1563 Protein 5e-35 43
Smed_0124 YP_001325819.1 two component transcriptional regulator VFG1702 Protein 5e-35 43