Gene Information

Name : Amet_0656 (Amet_0656)
Accession : YP_001318540.1
Strain : Alkaliphilus metalliredigens QYMF
Genome accession: NC_009633
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 691914 - 692603 bp
Length : 690 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cac:CAC0321 response regulator (CheY-like domain, HTH domain)

DNA sequence :
ATGAAAAAGATATTGATTCTAGAAGATGACATTAGTATTGCTGAACTACAACGAGATTATTTAGAAATTAATCAATTTGA
TGTGGATATTGAAGCAAGAGGAGATGAAGGATTACAAAGAGCCTTAAATCATGACTACGATTTGATTATATTAGATATTA
TGTTACCCGGTAAGGATGGTTTTGAGATCTGCAAGGAAATTAGACTCACTAAGAATACGCCTATATTGCTGGTTTCTGCG
AAAAAAGAAGATATCGATAAAGTTAGAGGGCTTGGTTTAGGGGCTGATGACTATATGACAAAGCCATTTAGTCCTAATGA
ACTGGTGGCTAGGGTAAGGGCGCATATTGCTCGCTTTGAAAGACTGACTTCAAATGAAGACATTCATAAAGGACTGATTC
AGGTAGGTGAAATATCCATTGAACAATTATCACGGAGCGTTTTTGTCAATCAAAAAGAAACAAACTTAACCACTAAGGAA
TTTGATTTATTATATTTGCTTGCACAGAACCCACAGCGGGTATTTAGAAAAGAAGAACTCTTTGAAACCATTTGGGGATG
GGATTCATTTGGTGATATTTCTACTGTGACAGTGCACATTCGAAGAATTAGAGAAAAAATAGAAAGAGATCCCTCCAATC
CTAAATACATTGAAACCATTTGGGGCGTTGGGTATAAATTTAGGGCTTAG

Protein sequence :
MKKILILEDDISIAELQRDYLEINQFDVDIEARGDEGLQRALNHDYDLIILDIMLPGKDGFEICKEIRLTKNTPILLVSA
KKEDIDKVRGLGLGADDYMTKPFSPNELVARVRAHIARFERLTSNEDIHKGLIQVGEISIEQLSRSVFVNQKETNLTTKE
FDLLYLLAQNPQRVFRKEELFETIWGWDSFGDISTVTVHIRRIREKIERDPSNPKYIETIWGVGYKFRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-39 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-39 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amet_0656 YP_001318540.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 1e-45 46
Amet_0656 YP_001318540.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 4e-47 46
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_012469.1.7685629. Protein 7e-42 45
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-40 44
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-40 44
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-40 44
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-40 44
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-40 44
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-40 44
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-40 44
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-40 44
Amet_0656 YP_001318540.1 two component transcriptional regulator AE016830.1.gene1681. Protein 3e-44 44
Amet_0656 YP_001318540.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-40 44
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-42 43
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-42 43
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-42 43
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-42 43
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-42 43
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-42 43
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-42 43
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-42 43
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-42 43
Amet_0656 YP_001318540.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-34 42
Amet_0656 YP_001318540.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 3e-37 42
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 9e-42 42
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-35 41
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-42 41
Amet_0656 YP_001318540.1 two component transcriptional regulator AM180355.1.gene1830. Protein 2e-38 41
Amet_0656 YP_001318540.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-42 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amet_0656 YP_001318540.1 two component transcriptional regulator VFG1563 Protein 2e-39 42
Amet_0656 YP_001318540.1 two component transcriptional regulator VFG1702 Protein 1e-39 42