Gene Information

Name : Amet_4758 (Amet_4758)
Accession : YP_001322483.1
Strain : Alkaliphilus metalliredigens QYMF
Genome accession: NC_009633
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4885824 - 4886513 bp
Length : 690 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cth:Cthe_2333 two component transcriptional regulator, winged helix family

DNA sequence :
ATGGAGAAGAAAATATTAATCGTTGAAGATGAAAAGCCTATTGCAGATATTTTAAAGTTTAATTTAGAAAAGGAAGGTTA
CCGCATAGAAATGGCCCATGATGGGGAGGATGCTTTGAAAAAAGTGAGTGAATTCATCCCTGATTTGGTTCTTCTAGATG
TGATGTTACCCAAATTAGACGGGTTTCAGGTCTGCCGAAAGATAAGAGAAAGTTTTTCTATGCCAATTTTGATGCTAACA
GCTAAGGAAGAAGAAGTAGACAAGGTGTTGGGTCTTGAGATTGGAGCTGATGATTATATTACAAAACCATTTGGCATGCG
TGAACTGCTGGCTAGGGTAAATGCAAATTTTAGACGCATGGAAGCACCTGCAGGATCACAAGGCGGTGGCAAGATTTCCT
CCGGTAAGTTATCCATCGACTTTAGTAAATATGAAGTAAAAAGAGACCAACTGGTCATTGAGTTAACCTCTAGGGAGTTC
GAGCTCTTGAAGTTTTTAGCAATTCAAGCAGAGCAGGTCTTTACAAGAGAACAGCTTTTAAAAGAAGTATGGGGATATGA
ATATTATGGAGATATTAGAACCGTAGATGTAACCGTAAGAAGATTGAGAGAAAAAGTTGAGGATGATTCCGGTAACCCTA
AATACATACAAACGAAGCGGGGCGTTGGGTATTATTTCAGGAGGGCCTAA

Protein sequence :
MEKKILIVEDEKPIADILKFNLEKEGYRIEMAHDGEDALKKVSEFIPDLVLLDVMLPKLDGFQVCRKIRESFSMPILMLT
AKEEEVDKVLGLEIGADDYITKPFGMRELLARVNANFRRMEAPAGSQGGGKISSGKLSIDFSKYEVKRDQLVIELTSREF
ELLKFLAIQAEQVFTREQLLKEVWGYEYYGDIRTVDVTVRRLREKVEDDSGNPKYIQTKRGVGYYFRRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-29 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-37 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_012469.1.7685629. Protein 3e-54 54
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-47 48
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-47 48
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-47 48
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-47 48
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-47 48
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-47 48
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-47 48
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-47 48
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-47 48
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-47 48
Amet_4758 YP_001322483.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-40 48
Amet_4758 YP_001322483.1 two component transcriptional regulator HE999704.1.gene2815. Protein 7e-45 47
Amet_4758 YP_001322483.1 two component transcriptional regulator HE999704.1.gene1528. Protein 4e-34 44
Amet_4758 YP_001322483.1 two component transcriptional regulator AE016830.1.gene1681. Protein 7e-42 44
Amet_4758 YP_001322483.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 7e-40 43
Amet_4758 YP_001322483.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-38 43
Amet_4758 YP_001322483.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 2e-35 43
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-35 43
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-35 43
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-34 42
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-34 42
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-34 42
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-34 42
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-34 42
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-34 42
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-34 42
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-34 42
Amet_4758 YP_001322483.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-41 42
Amet_4758 YP_001322483.1 two component transcriptional regulator BAC0308 Protein 1e-29 42
Amet_4758 YP_001322483.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 1e-36 42
Amet_4758 YP_001322483.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-28 41
Amet_4758 YP_001322483.1 two component transcriptional regulator AM180355.1.gene1830. Protein 2e-35 41
Amet_4758 YP_001322483.1 two component transcriptional regulator CP000034.1.gene3671. Protein 2e-35 41
Amet_4758 YP_001322483.1 two component transcriptional regulator BAC0596 Protein 5e-33 41
Amet_4758 YP_001322483.1 two component transcriptional regulator CP001138.1.gene2239. Protein 5e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amet_4758 YP_001322483.1 two component transcriptional regulator VFG0596 Protein 9e-30 42
Amet_4758 YP_001322483.1 two component transcriptional regulator VFG1563 Protein 6e-38 42
Amet_4758 YP_001322483.1 two component transcriptional regulator VFG1390 Protein 1e-39 41
Amet_4758 YP_001322483.1 two component transcriptional regulator VFG1702 Protein 2e-37 41