Gene Information

Name : Amet_3209 (Amet_3209)
Accession : YP_001321006.1
Strain : Alkaliphilus metalliredigens QYMF
Genome accession: NC_009633
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3260004 - 3260681 bp
Length : 678 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cac:CAC2435 response regulator (CheY-like domain and HTH-type DNA-binding domain)

DNA sequence :
ATGGTAGGAAGTCGGATTCTTTTAGTAGAGGATGAAAAAAACTTAAGAAAATTGGTGGCAACTTATTTAAAAAAGGAAAT
GGTCAGCGTAATTGAAGCAGCTGATGGTAAAGAGGCCTTGGTATTATGGGAAGAGGAGCAGTACGACCTGATTATTGTGG
ATATTATGCTTCCGGAGTATGATGGTTGGACAATTTGTAAAAGAATACGGGAAAAGAGTAATGTGCCTATATTAATATTA
ACAGCGCGAAGTGAAGAACATGATAAACTCTTTGGGTTTGATTTAGGGGTGGATGATTATATGACAAAACCTTTTAGTGT
AAAGGAACTGGTGGCTAGAGTGAAGGCTTTATTAAAGCGAAGTAATCGCCAGTTATCAACAGAAACTTTGATAGTACAAG
GATTGAAGGTAGATAAAAAAGGGCACCAAGTCTTTTTACAAGGTGAACGTCTTATGTTAACTCCTAAGGAATATGATCTG
CTTTTAATTTTCCTCCATAATCAAAACCAAGCGCTATCTAGAGAAGTAATTTTAGATGGAGTTTGGGGATATGATTATTA
TGGTGATTTGAGAACAGTGGATACTCATGTGAAGCGGTTAAGACATAAATTGAAGGAAATGGGAGAGCAGATTAAAACTG
TCCGAGGGCTAGGGTATCGGTTTGAGGTGACAAAGTGA

Protein sequence :
MVGSRILLVEDEKNLRKLVATYLKKEMVSVIEAADGKEALVLWEEEQYDLIIVDIMLPEYDGWTICKRIREKSNVPILIL
TARSEEHDKLFGFDLGVDDYMTKPFSVKELVARVKALLKRSNRQLSTETLIVQGLKVDKKGHQVFLQGERLMLTPKEYDL
LLIFLHNQNQALSREVILDGVWGYDYYGDLRTVDTHVKRLRHKLKEMGEQIKTVRGLGYRFEVTK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-35 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-41 44
Amet_3209 YP_001321006.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-33 44
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 9e-41 44
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 9e-41 44
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_012469.1.7685629. Protein 4e-39 44
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 9e-41 44
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 9e-41 44
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 7e-41 44
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 9e-41 44
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 9e-41 44
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 9e-41 44
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 9e-41 44
Amet_3209 YP_001321006.1 two component transcriptional regulator HE999704.1.gene2815. Protein 6e-41 44
Amet_3209 YP_001321006.1 two component transcriptional regulator AF310956.2.orf0.gene Protein 8e-36 42
Amet_3209 YP_001321006.1 two component transcriptional regulator U35369.1.gene1.p01 Protein 8e-36 42
Amet_3209 YP_001321006.1 two component transcriptional regulator AE016830.1.gene2255. Protein 8e-36 42
Amet_3209 YP_001321006.1 two component transcriptional regulator BAC0308 Protein 6e-31 41
Amet_3209 YP_001321006.1 two component transcriptional regulator AM180355.1.gene1830. Protein 7e-33 41
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-35 41
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-35 41
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-35 41
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-35 41
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-35 41
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-35 41
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-35 41
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-35 41
Amet_3209 YP_001321006.1 two component transcriptional regulator HE999704.1.gene1202. Protein 3e-35 41
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-40 41
Amet_3209 YP_001321006.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 1e-31 41
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 6e-35 41
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 3e-35 41
Amet_3209 YP_001321006.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 6e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amet_3209 YP_001321006.1 two component transcriptional regulator VFG1389 Protein 2e-27 42