Gene Information

Name : Amet_0288 (Amet_0288)
Accession : YP_001318179.1
Strain : Alkaliphilus metalliredigens QYMF
Genome accession: NC_009633
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 326809 - 327459 bp
Length : 651 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cac:CAC1506 response regulator (CheY-like receiver domain and a HTH)

DNA sequence :
GTGAGTGTGATTTTAATTATAGAGGATGAAGATCCGATTAGAGAGTTGATCAAATTAAATTTGGTGATGGCAGGGTATGA
AACGCTAGAGGCTTGTGATGGGGAAGAGGGTCTCCAGTATCTAAACAATGAAAAAATAGATTTAGTACTCTTGGATGTCA
TGCTTCCTCAACAGGATGGTTATACACTACTGCCTAAAATCTTAAAGAAGAATATACCTACAATTATGCTGACAGCAAAG
GATAGACTAAAGGACAAAGTAAAAGGCTTAGAAATGGGTGCCGATGATTATGTGACAAAACCCTTTGAAGCCATGGAGCT
TTTAGCTCGGGTCAAATGTGTTTTAAGGAGATCCGATAAAGAAAAAACAAAAATCGTAATGGATGATATTGAAATCTGCT
TAGACCAATGGAAGGTTTTAAAGGATGGCAAAGAAGTAGATTTAACTTATAAAGAGTTTGATCTTTTACGACTATTGATT
GAAAACAAGGGGAATGTCATGTCTCGAGATCGATTATTGGAACTGGTTTGGGGCTATGAATTTGAGGGAAATACGAGAAC
CGTTGATATGCATATTCAACGACTAAGGAATAAAATAGGGGCAGATAAGATTAAGACGATCTACAAGGTAGGCTATCGTA
TGGAGGGCTAA

Protein sequence :
MSVILIIEDEDPIRELIKLNLVMAGYETLEACDGEEGLQYLNNEKIDLVLLDVMLPQQDGYTLLPKILKKNIPTIMLTAK
DRLKDKVKGLEMGADDYVTKPFEAMELLARVKCVLRRSDKEKTKIVMDDIEICLDQWKVLKDGKEVDLTYKEFDLLRLLI
ENKGNVMSRDRLLELVWGYEFEGNTRTVDMHIQRLRNKIGADKIKTIYKVGYRMEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amet_0288 YP_001318179.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-36 45
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-39 45
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-37 44
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-37 44
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-37 44
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-37 44
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-37 44
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-37 44
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-37 44
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-37 44
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-37 44
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-37 44
Amet_0288 YP_001318179.1 two component transcriptional regulator AE015929.1.gene1106. Protein 3e-26 43
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 8e-32 43
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 8e-32 43
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 8e-32 43
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 8e-32 43
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 8e-32 43
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 8e-32 43
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 8e-32 43
Amet_0288 YP_001318179.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 8e-32 43
Amet_0288 YP_001318179.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 1e-29 42
Amet_0288 YP_001318179.1 two component transcriptional regulator BAC0197 Protein 3e-33 42
Amet_0288 YP_001318179.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 2e-30 41
Amet_0288 YP_001318179.1 two component transcriptional regulator EU250284.1.orf4.gene Protein 1e-30 41
Amet_0288 YP_001318179.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 5e-34 41
Amet_0288 YP_001318179.1 two component transcriptional regulator AF310956.2.orf0.gene Protein 5e-34 41
Amet_0288 YP_001318179.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-27 41