Gene Information

Name : Amet_1770 (Amet_1770)
Accession : YP_001319601.1
Strain : Alkaliphilus metalliredigens QYMF
Genome accession: NC_009633
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1886963 - 1887667 bp
Length : 705 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bat:BAS0256 DNA-binding response regulator

DNA sequence :
TTGGCAGGCGAAACGATACTGGTTGTAGATGATGATGAGGATATTAGAGAGATTATCACTTTATACTTAGAAAAAGAAGG
ATATCAGGTGATTTTAGCTATGGATGGTCATCAAGCATTAGAATGTGCATTCTCTTTCAATCCCGACTTAGTTATTCTAG
ATATGATGATTCCTGGTTTAGACGGCATTGAAGTGTGCCAGGCATTACGTAAAAATTTATCTACACCTATTATTTTTCTG
AGTTGCAAATCTACTCCAAGTGATAAATCCATCGGATTAATAGCTGGTGGAGATGACTATATGAGTAAGCCCTTTGATAC
AATGGAACTTCTGGCAAGGATTAAGGCTCATTTGCGTCGAAATCGTATACTGGAAAATTCAAACTACAGCAATGCCCAAA
ATAAACGATTATGTTATGGGGATTTGACTATTAATTTAGACAATCATTCTGTGGTAGTATACGGACAAGAAATTATTTTA
TCTCCTAAGGAGTTCCAACTATTGACTCTATTAGCCAAAAATCCTAATAGGGTATTTAGTAATGAACAATTATTTGAAAC
CCTTTGGGCTACTGAGAGTTTTGGAGATCATAGAACAGTGATGGTTCATATAAGTAACATACGAAAAAAGATAGAGAGAG
ATGCTAAAAAGCCAGCATTGATTCAAACGGTTAAAGGCGTTGGATATAAGTTTTGCGCAACATAA

Protein sequence :
MAGETILVVDDDEDIREIITLYLEKEGYQVILAMDGHQALECAFSFNPDLVILDMMIPGLDGIEVCQALRKNLSTPIIFL
SCKSTPSDKSIGLIAGGDDYMSKPFDTMELLARIKAHLRRNRILENSNYSNAQNKRLCYGDLTINLDNHSVVVYGQEIIL
SPKEFQLLTLLAKNPNRVFSNEQLFETLWATESFGDHRTVMVHISNIRKKIERDAKKPALIQTVKGVGYKFCAT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
sboR YP_006309915.1 SboR Not tested FWisland_1 Protein 3e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amet_1770 YP_001319601.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-48 47
Amet_1770 YP_001319601.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 6e-48 46
Amet_1770 YP_001319601.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-38 45
Amet_1770 YP_001319601.1 two component transcriptional regulator HE999704.1.gene2815. Protein 8e-37 45
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-37 44
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_012469.1.7686381. Protein 9e-35 43
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-36 43
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-36 43
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-36 43
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-36 43
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-36 43
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-36 43
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-36 43
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-36 43
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-36 43
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-36 43
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-29 41
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-29 41
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-29 41
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-29 41
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-29 41
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-29 41
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-29 41
Amet_1770 YP_001319601.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-29 41
Amet_1770 YP_001319601.1 two component transcriptional regulator AM180355.1.gene1830. Protein 1e-35 41
Amet_1770 YP_001319601.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 6e-35 41