Gene Information

Name : SaurJH1_0031 (SaurJH1_0031)
Accession : YP_001315186.1
Strain : Staphylococcus aureus JH1
Genome accession: NC_009632
Putative virulence/resistance : Resistance
Product : penicillinase repressor
Function : -
COG functional category : K : Transcription
COG ID : COG3682
EC number : -
Position : 42675 - 43046 bp
Length : 372 bp
Strand : +
Note : PFAM: Penicillinase repressor; KEGG: ser:SERP2519 methicillin-resistance regulatory protein MecI

DNA sequence :
ATGGATAATAAAACGTATGAAATATCATCTGCAGAATGGGAAGTTATGAATATCATTTGGATGAAAAAATATGCAAGTGC
GAATAATATAATAGAAGAAATACAAATGCAAAAGGACTGGAGTCCAAAAACCATTCGTACACTTATAACGAGATTGTATA
AAAAGGGATTTATAGATCGTAAAAAAGACAATAAAATTTTTCAATATTACTCTCTTGTAGAAGAAAGTGATATAAAATAT
AAAACATCTAAAAACTTTATCAATAAAGTATACAAAGGCGGTTTCAATTCACTTGTCTTAAACTTTGTAGAAAAAGAAGA
TCTATCACAAGATGAAATAGAAGAATTGAGAAATATATTGAATAAAAAATAA

Protein sequence :
MDNKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQYYSLVEESDIKY
KTSKNFINKVYKGGFNSLVLNFVEKEDLSQDEIEELRNILNKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mecI NP_373280.1 methicillin resistance regulatory protein Not tested Type-II SCCmec Protein 4e-50 100
mecI YP_190060.1 methicillin-resistance regulatory protein MecI Not tested Type-II SCCmec Protein 4e-50 100
mecI BAA82218.1 methicillin resistance protein MecI Not tested Type-II SCCmec Protein 3e-50 100
mecI YP_039517.1 methicillin resistance regulatory protein MecI Not tested Type-II SCCmec Protein 3e-46 100
mecI NP_370567.1 methicillin resistance regulatory protein Not tested Type-II SCCmec Protein 2e-49 99
mecI YP_005754043.1 methicillin resistance regulatory protein MecI Not tested Type-XI SCCmec Protein 3e-37 67
blaI YP_253677.1 beta-lactamase repressor Not tested ¥ÕSh1 Protein 1e-25 62

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SaurJH1_0031 YP_001315186.1 penicillinase repressor NC_002745.1122814.p0 Protein 1e-50 100
SaurJH1_0031 YP_001315186.1 penicillinase repressor NC_002952.2861158.p0 Protein 9e-47 100
SaurJH1_0031 YP_001315186.1 penicillinase repressor NC_002758.1120003.p0 Protein 6e-50 99
SaurJH1_0031 YP_001315186.1 penicillinase repressor NC_009782.5560220.p0 Protein 6e-50 99
SaurJH1_0031 YP_001315186.1 penicillinase repressor FR823292.1.gene6.p01 Protein 9e-38 67
SaurJH1_0031 YP_001315186.1 penicillinase repressor NC_005054.2598289.p0 Protein 3e-26 62
SaurJH1_0031 YP_001315186.1 penicillinase repressor NC_003140.1122763.p0 Protein 4e-26 62
SaurJH1_0031 YP_001315186.1 penicillinase repressor NC_005011.2598314.p0 Protein 3e-26 62
SaurJH1_0031 YP_001315186.1 penicillinase repressor NC_005951.2853407.p0 Protein 3e-26 62
SaurJH1_0031 YP_001315186.1 penicillinase repressor NC_002952.2858973.p0 Protein 3e-26 62
SaurJH1_0031 YP_001315186.1 penicillinase repressor NC_010419.6155809.p0 Protein 4e-26 62
SaurJH1_0031 YP_001315186.1 penicillinase repressor NC_010066.5774788.p0 Protein 3e-26 62
SaurJH1_0031 YP_001315186.1 penicillinase repressor AM180355.1.gene595.p Protein 1e-20 48