Gene Information

Name : Cbei_2249 (Cbei_2249)
Accession : YP_001309368.1
Strain : Clostridium beijerinckii NCIMB 8052
Genome accession: NC_009617
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2612293 - 2612976 bp
Length : 684 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: ctc:CTC00805 two-component response regulator

DNA sequence :

ATGAAAACAAATATTTTAGTTGTAGATGATGATAAGAGTATTCGTAATTTAATCAAAGTTTATCTTGAGAATGAAGGTTA
TAATATTATGGAAGCTTCAAATGGAGCGGAAGCTTTGATTTTGATTAATGAAAATAATTTTGATTTAATTATTTTAGATG
TTATGATGCCAGTTTTAGATGGCATAAGCGCTTGCCTTAAAATTAGAGAAGATTACACTATGCCTATAATATTTTTATCG
GCAAAAGATGAAGAAATTCATAAAATTGAAGGTTTAACAGTTGGCGCTGATGATTATATTACTAAACCTTTTGGTTCTAT
GGAGCTTATAGCTAGAGTAAAGGCTCAACTTAGAAGATATAAAAAATTTAATGTAGAACCTCAAAATAGTAGTAGTATTA
CTATTGAAGAATTAACTATTAATTTTGATACTCATGAAGTTACAGTGAGAGGTGATAAAATTAAGCTTACTCCAAAGGAG
TTTGATATATTGGAGTGTTTAGCTAAAAATAGAGGTGTAGTATTTTCTGTACAAAAATTGTATGAGACTATTTGGAATGA
ACAATTTGCAGTATCAGATACTTCTATAGTGGTTCATATAACAAACCTTAGACAAAAAATTGAAATAGATCCTAAAAGCC
CAAAATATATTAAAACAGTTTGGGGAGTTGGATATAAGATATGA

Protein sequence :

MKTNILVVDDDKSIRNLIKVYLENEGYNIMEASNGAEALILINENNFDLIILDVMMPVLDGISACLKIREDYTMPIIFLS
AKDEEIHKIEGLTVGADDYITKPFGSMELIARVKAQLRRYKKFNVEPQNSSSITIEELTINFDTHEVTVRGDKIKLTPKE
FDILECLAKNRGVVFSVQKLYETIWNEQFAVSDTSIVVHITNLRQKIEIDPKSPKYIKTVWGVGYKI

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
nisR2	YP_006309922.1	NisR	Not tested	FWisland_1	Protein	1e-28	41

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
Cbei_2249	YP_001309368.1	two component transcriptional regulator	NC_014475.1.orf0.gen	Protein	1e-52	51
Cbei_2249	YP_001309368.1	two component transcriptional regulator	NC_005054.2598277.p0	Protein	1e-52	51
Cbei_2249	YP_001309368.1	two component transcriptional regulator	AM180355.1.gene1830.	Protein	5e-51	49
Cbei_2249	YP_001309368.1	two component transcriptional regulator	DQ212986.1.gene4.p01	Protein	3e-49	48
Cbei_2249	YP_001309368.1	two component transcriptional regulator	AF130997.1.orf0.gene	Protein	8e-48	46
Cbei_2249	YP_001309368.1	two component transcriptional regulator	FJ349556.1.orf0.gene	Protein	2e-49	46
Cbei_2249	YP_001309368.1	two component transcriptional regulator	HE999704.1.gene2815.	Protein	1e-41	46
Cbei_2249	YP_001309368.1	two component transcriptional regulator	EU250284.1.orf4.gene	Protein	6e-48	45
Cbei_2249	YP_001309368.1	two component transcriptional regulator	NC_002952.2859905.p0	Protein	1e-40	45
Cbei_2249	YP_001309368.1	two component transcriptional regulator	NC_002951.3237708.p0	Protein	2e-40	45
Cbei_2249	YP_001309368.1	two component transcriptional regulator	NC_003923.1003749.p0	Protein	1e-40	45
Cbei_2249	YP_001309368.1	two component transcriptional regulator	NC_002758.1121668.p0	Protein	2e-40	45
Cbei_2249	YP_001309368.1	two component transcriptional regulator	NC_007622.3794472.p0	Protein	1e-40	45
Cbei_2249	YP_001309368.1	two component transcriptional regulator	NC_009641.5332272.p0	Protein	2e-40	45
Cbei_2249	YP_001309368.1	two component transcriptional regulator	NC_013450.8614421.p0	Protein	2e-40	45
Cbei_2249	YP_001309368.1	two component transcriptional regulator	NC_007793.3914279.p0	Protein	2e-40	45
Cbei_2249	YP_001309368.1	two component transcriptional regulator	NC_002745.1124361.p0	Protein	2e-40	45
Cbei_2249	YP_001309368.1	two component transcriptional regulator	NC_009782.5559369.p0	Protein	2e-40	45
Cbei_2249	YP_001309368.1	two component transcriptional regulator	AF155139.2.orf0.gene	Protein	7e-50	45
Cbei_2249	YP_001309368.1	two component transcriptional regulator	AE016830.1.gene1681.	Protein	1e-40	44
Cbei_2249	YP_001309368.1	two component transcriptional regulator	NC_012469.1.7685629.	Protein	3e-37	43
Cbei_2249	YP_001309368.1	two component transcriptional regulator	AF162694.1.orf4.gene	Protein	2e-46	42