Gene Information

Name : Cbei_1731 (Cbei_1731)
Accession : YP_001308859.1
Strain : Clostridium beijerinckii NCIMB 8052
Genome accession: NC_009617
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2003459 - 2004136 bp
Length : 678 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cno:NT01CX_1513 two-component response regulator

DNA sequence :
ATGAAGGGGAAAAGGATACTAGTTGTTGATGACGAACCATTAATAAGAAAGCTCGTAACAGATTTTCTGAAAAAACAAGG
GTATGTAACAATTGAGGCTGATGATGGAAAGAAAGCTATGAATTTGTTTTCTAATGAGGAAAATATAGATTTAATAATTC
TTGATGTAATGCTGCCAGAATATGATGGATTTACTGTATGCAGAGAGATAAGAAAGAAATCTAAAGTTCCGATTATTATG
CTAACTGCAAGAGGAGAGGAATTTGATGAAGTTTTTGGATTAGATATTGGAGCTGATGAGTATATATCAAAACCTTTTAG
TCCTAATATACTAATAGCGAGAGTTAATGCTGTTCTGAGAAGGGCAAATTCAGAAGATAAAGGTAAAGAACTCAAAGATT
TTAATGGATTGACAATAGACCATAGTGCCCATCAAGTAGTTATAGATGGAGAAGTTGTTGATTTAAGTCCTAAGGAATAT
GAACTATTGATTTATCTTTCTGAAAATTATGGAAAAGCATTAAGTAGAGAGCAAATATTAGATAAGGTATGGGGATATGA
TTATTATGGAGACTTAAGGACAGTGGATACACATATAAATAGATTAAGAATAAAGTTAGATAGAAAAAGTGATTATATAC
AAACAGTACGCGGTTACGGTTATAGGTTTGAGGAATAG

Protein sequence :
MKGKRILVVDDEPLIRKLVTDFLKKQGYVTIEADDGKKAMNLFSNEENIDLIILDVMLPEYDGFTVCREIRKKSKVPIIM
LTARGEEFDEVFGLDIGADEYISKPFSPNILIARVNAVLRRANSEDKGKELKDFNGLTIDHSAHQVVIDGEVVDLSPKEY
ELLIYLSENYGKALSREQILDKVWGYDYYGDLRTVDTHINRLRIKLDRKSDYIQTVRGYGYRFEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-34 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 7e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-43 46
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-43 46
Cbei_1731 YP_001308859.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-42 45
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-43 45
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-43 45
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-43 45
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-43 45
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-43 45
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-43 45
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-43 45
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-43 45
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_012469.1.7685629. Protein 3e-43 44
Cbei_1731 YP_001308859.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 5e-37 43
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_012469.1.7686381. Protein 5e-48 43
Cbei_1731 YP_001308859.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-31 43
Cbei_1731 YP_001308859.1 two component transcriptional regulator HE999704.1.gene2815. Protein 9e-45 43
Cbei_1731 YP_001308859.1 two component transcriptional regulator AF310956.2.orf0.gene Protein 2e-34 42
Cbei_1731 YP_001308859.1 two component transcriptional regulator BAC0596 Protein 1e-37 42
Cbei_1731 YP_001308859.1 two component transcriptional regulator BAC0039 Protein 9e-38 42
Cbei_1731 YP_001308859.1 two component transcriptional regulator CP000647.1.gene2531. Protein 2e-38 42
Cbei_1731 YP_001308859.1 two component transcriptional regulator CP001138.1.gene2239. Protein 1e-37 42
Cbei_1731 YP_001308859.1 two component transcriptional regulator CP000034.1.gene2186. Protein 9e-38 42
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_002695.1.916589.p Protein 7e-38 42
Cbei_1731 YP_001308859.1 two component transcriptional regulator CP001918.1.gene3444. Protein 2e-37 42
Cbei_1731 YP_001308859.1 two component transcriptional regulator AF253562.2.orf0.gene Protein 6e-25 42
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-33 41
Cbei_1731 YP_001308859.1 two component transcriptional regulator AE016830.1.gene2255. Protein 3e-33 41
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-33 41
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-33 41
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-33 41
Cbei_1731 YP_001308859.1 two component transcriptional regulator U35369.1.gene1.p01 Protein 3e-33 41
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-33 41
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-33 41
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-33 41
Cbei_1731 YP_001308859.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-33 41
Cbei_1731 YP_001308859.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 1e-38 41
Cbei_1731 YP_001308859.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 6e-35 41
Cbei_1731 YP_001308859.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 4e-35 41
Cbei_1731 YP_001308859.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-42 41
Cbei_1731 YP_001308859.1 two component transcriptional regulator EU250284.1.orf4.gene Protein 6e-36 41
Cbei_1731 YP_001308859.1 two component transcriptional regulator HE999704.1.gene1528. Protein 6e-32 41