Gene Information

Name : TBFG_10921 (TBFG_10921)
Accession : YP_001286866.1
Strain : Mycobacterium tuberculosis F11
Genome accession: NC_009565
Putative virulence/resistance : Virulence
Product : two component system response transcriptional regulatory protein prrA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1009677 - 1010387 bp
Length : 711 bp
Strand : -
Note : Mapped to H37Rv Rv0903c

DNA sequence :
ATGGGCGGCATGGACACTGGTGTGACCTCACCTCGGGTGTTGGTCGTCGACGACGACTCCGATGTGCTCGCCTCGCTGGA
ACGCGGCTTACGGCTGTCCGGATTCGAGGTAGCGACCGCGGTGGACGGCGCCGAGGCCTTGCGCAGCGCCACCGAGAACC
GGCCGGACGCGATCGTGCTCGACATCAACATGCCAGTGCTCGATGGAGTCAGCGTCGTGACGGCACTACGCGCGATGGAC
AACGACGTCCCGGTCTGTGTGCTATCCGCACGCAGCTCTGTCGATGACCGAGTGGCCGGATTGGAGGCCGGCGCCGACGA
TTACCTGGTGAAACCGTTCGTGCTGGCCGAGCTGGTGGCACGGGTGAAGGCGCTGCTGCGCCGCCGCGGCTCCACTGCAA
CGTCGTCCTCGGAAACCATCACGGTGGGCCCGCTGGAGGTGGACATCCCCGGCCGGCGGGCCCGGGTCAACGGCGTCGAC
GTCGACCTGACCAAGCGCGAATTCGACCTGCTCGCGGTGCTGGCCGAGCACAAGACCGCGGTGCTCTCCCGAGCGCAACT
CCTGGAATTGGTGTGGGGCTACGACTTCGCCGCCGACACCAACGTGGTGGACGTCTTCATCGGGTACCTGCGGCGCAAAC
TGGAGGCCGGCGGTGGCCCTAGGCTGCTGCATACCGTCCGCGGAGTCGGATTCGTGCTGCGTATGCAGTGA

Protein sequence :
MGGMDTGVTSPRVLVVDDDSDVLASLERGLRLSGFEVATAVDGAEALRSATENRPDAIVLDINMPVLDGVSVVTALRAMD
NDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRRRGSTATSSSETITVGPLEVDIPGRRARVNGVD
VDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEAGGGPRLLHTVRGVGFVLRMQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-25 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA BAC0083 Protein 5e-31 46
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA BAC0125 Protein 7e-30 43
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA HE999704.1.gene1528. Protein 2e-31 43
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA BAC0197 Protein 6e-25 43
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA BAC0638 Protein 4e-24 43
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA NC_012469.1.7685629. Protein 4e-28 43
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA AE000516.2.gene3505. Protein 6e-29 43
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA BAC0308 Protein 1e-27 42
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA NC_002952.2859905.p0 Protein 2e-27 42
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA NC_003923.1003749.p0 Protein 3e-27 42
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA NC_002758.1121668.p0 Protein 3e-27 42
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA NC_009641.5332272.p0 Protein 3e-27 42
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA NC_013450.8614421.p0 Protein 3e-27 42
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA NC_007793.3914279.p0 Protein 3e-27 42
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA NC_002745.1124361.p0 Protein 3e-27 42
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA NC_007622.3794472.p0 Protein 2e-27 42
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA NC_009782.5559369.p0 Protein 3e-27 42
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA NC_002951.3237708.p0 Protein 3e-27 42
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA HE999704.1.gene2815. Protein 3e-27 42
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA BAC0347 Protein 8e-24 41
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA BAC0111 Protein 5e-26 41
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA NC_012469.1.7686381. Protein 2e-23 41
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA NC_002516.2.879194.p Protein 1e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA VFG1389 Protein 1e-87 100
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA VFG1390 Protein 2e-41 50
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA VFG1386 Protein 1e-36 46
TBFG_10921 YP_001286866.1 two component system response transcriptional regulatory protein prrA VFG0596 Protein 7e-26 42