Gene Information

Name : PsycPRwf_0077 (PsycPRwf_0077)
Accession : YP_001278987.1
Strain : Psychrobacter sp. PRwf-1
Genome accession: NC_009524
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 95318 - 95893 bp
Length : 576 bp
Strand : +
Note : PFAM: stress protein

DNA sequence :
ATGGCTATTAGCTTAACCAAAGGCGGCAACGTTAACTTATCAAAAGAAGCCCCTGGTCTTACCAATATCACCATCGGCTT
AGGCTGGGATCCACGCGCCACAGACGGCCAAGACTTCGATCTAGATGCCATCGCCTTTTTATTAAACGATGCAGGTAAAG
TACGTAACGACCAAGACTTTATCTTCTTTAACAACCTAAAATCAGGTGATGGCTCAGTTGAGCACACAGGCGACAACCGC
ACGGGTGAAGGTGATGGTGATGATGAAGCCATCAAAGTAGACCTAACTCGTGTGCCTAGCGATGTGTCTAAAATTGCGGT
GTGTGCCATTATCTATGAAGGTCAAGCCCGCAACCAAAACTTCGGTCAAGTAGCCGATGCCTTTATTCGTGTAGTGAACG
ACAATGGCGCGACTGAAATTGCTCGCTTTGATCTATCAGAAGATGGCAGCACCGAAACCGCTATGATTTTTGGTGAAATC
TATCGCCACAACGGTGAGTGGAAATTCCGTGCAGTCGGTCAAGGTTTCAGCGGTGGTCTAGGTCCATTAGCGGCCTCTTA
TGGTGTTGCGGTTTAA

Protein sequence :
MAISLTKGGNVNLSKEAPGLTNITIGLGWDPRATDGQDFDLDAIAFLLNDAGKVRNDQDFIFFNNLKSGDGSVEHTGDNR
TGEGDGDDEAIKVDLTRVPSDVSKIAVCAIIYEGQARNQNFGQVADAFIRVVNDNGATEIARFDLSEDGSTETAMIFGEI
YRHNGEWKFRAVGQGFSGGLGPLAASYGVAV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-66 71
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-63 68
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-63 68
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-63 67
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-59 63
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-59 63
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-59 63
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-57 63
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-26 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PsycPRwf_0077 YP_001278987.1 stress protein BAC0389 Protein 7e-63 67
PsycPRwf_0077 YP_001278987.1 stress protein BAC0390 Protein 4e-60 62