Gene Information

Name : PsycPRwf_0075 (PsycPRwf_0075)
Accession : YP_001278985.1
Strain : Psychrobacter sp. PRwf-1
Genome accession: NC_009524
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 93199 - 93774 bp
Length : 576 bp
Strand : +
Note : PFAM: stress protein

DNA sequence :
ATGGCGTTATCGTTAAGTAAAGGCGGGAACTTATCCCTGACAAAAACTGACCCTAATTTAAACAAACTTTTAGTTGGATT
AGGCTGGGATGAAAGAGCGACATCAGGTGCTGAGTTTGACTTGGATGCCAGCGTATTTTTGTTAAATAATACAGGACGTG
TACGCGGCGATCATGACTTCATCTTTTATAACCAATTAAAGTCAGACAACGGCGCCGTTGAACACACCGGTGATAACCGT
ACTGGGGAAGGTGATGGTGATGATGAGGTGATCAAAGTAGATCTGTCTCGCCTGCCTGCAGATGTGGACAAGGTGGTGGT
AACCGTCACCATTCATGACGCCCAAGTACGCAATCAAAACTTTGGCCAAGTTGCCAACGCCTTTATCCGTGTGGTCAATG
AAGAGACGGGCGTAGAGGTGGTTCGTTTTGATTTGGCTGAGGATTATTCTGTTGAAACAGCCATGGTGTTTGGTGAAGTA
TATCGGCATAATAACGAGTGGAAATTCCGCGCCGTCGGACAAGGTTATTCCGGCGGTTTACAAGCGATGTGTCAAAACTA
TGGTGTTGTAATCTAA

Protein sequence :
MALSLSKGGNLSLTKTDPNLNKLLVGLGWDERATSGAEFDLDASVFLLNNTGRVRGDHDFIFYNQLKSDNGAVEHTGDNR
TGEGDGDDEVIKVDLSRLPADVDKVVVTVTIHDAQVRNQNFGQVANAFIRVVNEETGVEVVRFDLAEDYSVETAMVFGEV
YRHNNEWKFRAVGQGYSGGLQAMCQNYGVVI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-67 72
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-64 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-64 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-64 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-54 61
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-54 61
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-54 61
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-55 60
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-27 43
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-25 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PsycPRwf_0075 YP_001278985.1 stress protein BAC0389 Protein 5e-64 66
PsycPRwf_0075 YP_001278985.1 stress protein BAC0390 Protein 5e-58 62
PsycPRwf_0075 YP_001278985.1 stress protein BAC0392 Protein 7e-25 42