Gene Information

Name : RoseRS_3818 (RoseRS_3818)
Accession : YP_001278122.1
Strain : Roseiflexus sp. RS-1
Genome accession: NC_009523
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4776811 - 4777503 bp
Length : 693 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGCATATGTCCACCATTCTGCTGGTAGAGGATGATCCGATCCTTTCAGAAACGTTACGCTACAATCTGGAACGGGAAGG
GTACGCGGTCATCAACGCTCCTGACGGCGTTGTCGGTCTGGAACGGGCGCGACGCGATCAACCCGATATGGTCATTCTCG
ATGTGATGCTCCCCCGTCTGGATGGATTTTCCGTCTGTCGCATTCTGCGCCAGGAGAGCGAAGTTCCCATCCTGATCCTG
ACGGCGCGACAGGACGAGATTGATCGCATCGCAGGGCTGGAGTTGGGCGCCGATGATTACGTTGCCAAGCCATTCAGCCT
CGGAGAACTGCTGGCGCGGGTGCGGGCGATTATGCGCCGCTCAGATCGCCGCATCAGTGCGCTGCGTGAGGTGCTCGACG
CTGGCGCGATCCGGTTGGATACCGGCTCACGGCGCGCCTGGCGCGATGATGTCGAACTGAACCTGTCCCAGAAAGAGTTC
GATCTGCTGGCATGCCTGATGCGCAACCGCGGCATCGCGTTGTCGCGTGATGTCCTGCTCGAGCGCGTCTGGGGGTACGA
CTTCCTCGGCGATAGCCGGACGGTCGATGTGCACATTCGCTGGTTGCGCGAGAAGGTTGAACCCGACCCCGGCAAGCCGA
CCTATATTCAGACGGTTCGCGGCATTGGCTATCGTTTCGAGGCGCCAGACTGA

Protein sequence :
MHMSTILLVEDDPILSETLRYNLEREGYAVINAPDGVVGLERARRDQPDMVILDVMLPRLDGFSVCRILRQESEVPILIL
TARQDEIDRIAGLELGADDYVAKPFSLGELLARVRAIMRRSDRRISALREVLDAGAIRLDTGSRRAWRDDVELNLSQKEF
DLLACLMRNRGIALSRDVLLERVWGYDFLGDSRTVDVHIRWLREKVEPDPGKPTYIQTVRGIGYRFEAPD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-31 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-31 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RoseRS_3818 YP_001278122.1 two component transcriptional regulator AE016830.1.gene1681. Protein 3e-51 47
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-51 47
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-51 47
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-51 47
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 7e-51 47
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-51 47
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-51 47
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-51 47
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-51 47
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-51 47
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-51 47
RoseRS_3818 YP_001278122.1 two component transcriptional regulator BAC0197 Protein 3e-36 46
RoseRS_3818 YP_001278122.1 two component transcriptional regulator AE000516.2.gene3505. Protein 9e-41 46
RoseRS_3818 YP_001278122.1 two component transcriptional regulator BAC0125 Protein 3e-37 45
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_012469.1.7685629. Protein 9e-49 45
RoseRS_3818 YP_001278122.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-48 44
RoseRS_3818 YP_001278122.1 two component transcriptional regulator HE999704.1.gene1528. Protein 4e-38 43
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 8e-41 42
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 8e-41 42
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 8e-41 42
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 8e-41 42
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 8e-41 42
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 8e-41 42
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 8e-41 42
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 8e-41 42
RoseRS_3818 YP_001278122.1 two component transcriptional regulator AE015929.1.gene1106. Protein 2e-38 42
RoseRS_3818 YP_001278122.1 two component transcriptional regulator CP000675.2.gene1535. Protein 2e-38 42
RoseRS_3818 YP_001278122.1 two component transcriptional regulator BAC0347 Protein 3e-35 41
RoseRS_3818 YP_001278122.1 two component transcriptional regulator BAC0083 Protein 4e-35 41
RoseRS_3818 YP_001278122.1 two component transcriptional regulator NC_012469.1.7686381. Protein 5e-44 41
RoseRS_3818 YP_001278122.1 two component transcriptional regulator CP000034.1.gene3671. Protein 4e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RoseRS_3818 YP_001278122.1 two component transcriptional regulator VFG1390 Protein 1e-41 45
RoseRS_3818 YP_001278122.1 two component transcriptional regulator VFG1389 Protein 4e-39 45
RoseRS_3818 YP_001278122.1 two component transcriptional regulator VFG0596 Protein 2e-31 43
RoseRS_3818 YP_001278122.1 two component transcriptional regulator VFG1386 Protein 5e-41 43