Gene Information

Name : RoseRS_0114 (RoseRS_0114)
Accession : YP_001274504.1
Strain : Roseiflexus sp. RS-1
Genome accession: NC_009523
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 134569 - 135258 bp
Length : 690 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGGCCGCTACGATCCTCGTTGTTGAGGATGAGGAGCCGATTCTGAATCTGGTCGTCGCCTATCTCAAGGCCGACGGCTT
TGTCGTTCATACTGCGCGCGATGGTGAATCGGCACTGCAACAGGCGCAGATAGTGCGTCCTGACCTGGTTGTGCTCGACC
TCCTGCTTCCCGGAATTGATGGTCTTGAAATTTGTCGCCGCTTGCAGCACGATGGCGGTCCGTATGTCCTTATGCTCACT
GCGCGTGCAGAGGAGGTTGATAAGGTCGTTGGTCTGTCGGTGGGCGCCGATGACTATCTGACCAAACCATTCAGCCCGCG
CGAACTGGTAGCGCGCGTCAAGGCGATCCTGCGCCGCCGGCGGCATACGGGGGCGGCGCCAGCTGAGAATACGCTCCTGA
CGTTTCGCGATCTTCAAATCGATGTTGCGCGACGAGAGGTGCAGCGGCGCGGCGTGCCGGTGACGCTGACGGCGCGTGAG
TTCGATCTGCTCTACACGCTGGCTGCAATGCCGGGACGTGTGTTTACGCGCGAGCAACTCCTGGAACGGGTTTGGGGTCA
CGATTTCGACGGCGTTGATCGCGTTGTTGATGTGCATATCAGTCTGTTACGCCGGAAACTTGAGGATGATCCCGCTGAGC
CGACGCTGATCCAGACGGTGCGGGGGGTTGGATATAAGTTTACCGGTTGA

Protein sequence :
MAATILVVEDEEPILNLVVAYLKADGFVVHTARDGESALQQAQIVRPDLVVLDLLLPGIDGLEICRRLQHDGGPYVLMLT
ARAEEVDKVVGLSVGADDYLTKPFSPRELVARVKAILRRRRHTGAAPAENTLLTFRDLQIDVARREVQRRGVPVTLTARE
FDLLYTLAAMPGRVFTREQLLERVWGHDFDGVDRVVDVHISLLRRKLEDDPAEPTLIQTVRGVGYKFTG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-31 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-31 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-24 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RoseRS_0114 YP_001274504.1 two component transcriptional regulator HE999704.1.gene2815. Protein 9e-35 48
RoseRS_0114 YP_001274504.1 two component transcriptional regulator AE000516.2.gene3505. Protein 4e-34 48
RoseRS_0114 YP_001274504.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-39 47
RoseRS_0114 YP_001274504.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-39 47
RoseRS_0114 YP_001274504.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-39 47
RoseRS_0114 YP_001274504.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-39 47
RoseRS_0114 YP_001274504.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-39 47
RoseRS_0114 YP_001274504.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-39 47
RoseRS_0114 YP_001274504.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-39 47
RoseRS_0114 YP_001274504.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-39 47
RoseRS_0114 YP_001274504.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-39 47
RoseRS_0114 YP_001274504.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-39 47
RoseRS_0114 YP_001274504.1 two component transcriptional regulator NC_012469.1.7685629. Protein 7e-33 47
RoseRS_0114 YP_001274504.1 two component transcriptional regulator AE016830.1.gene1681. Protein 7e-37 46
RoseRS_0114 YP_001274504.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-40 45
RoseRS_0114 YP_001274504.1 two component transcriptional regulator BAC0197 Protein 1e-27 44
RoseRS_0114 YP_001274504.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 3e-30 43
RoseRS_0114 YP_001274504.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 2e-30 43
RoseRS_0114 YP_001274504.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 3e-30 43
RoseRS_0114 YP_001274504.1 two component transcriptional regulator CP001918.1.gene3444. Protein 6e-30 43
RoseRS_0114 YP_001274504.1 two component transcriptional regulator BAC0039 Protein 1e-30 43
RoseRS_0114 YP_001274504.1 two component transcriptional regulator CP001138.1.gene2239. Protein 3e-30 43
RoseRS_0114 YP_001274504.1 two component transcriptional regulator CP000034.1.gene2186. Protein 1e-30 43
RoseRS_0114 YP_001274504.1 two component transcriptional regulator CP000034.1.gene3671. Protein 6e-37 43
RoseRS_0114 YP_001274504.1 two component transcriptional regulator CP000647.1.gene2531. Protein 4e-30 43
RoseRS_0114 YP_001274504.1 two component transcriptional regulator BAC0596 Protein 3e-30 43
RoseRS_0114 YP_001274504.1 two component transcriptional regulator NC_002695.1.916589.p Protein 2e-30 43
RoseRS_0114 YP_001274504.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 3e-28 42
RoseRS_0114 YP_001274504.1 two component transcriptional regulator NC_008702.1.4607594. Protein 9e-29 42
RoseRS_0114 YP_001274504.1 two component transcriptional regulator AE015929.1.gene1106. Protein 5e-26 41
RoseRS_0114 YP_001274504.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 3e-31 41
RoseRS_0114 YP_001274504.1 two component transcriptional regulator BAC0083 Protein 1e-24 41
RoseRS_0114 YP_001274504.1 two component transcriptional regulator BAC0111 Protein 1e-23 41
RoseRS_0114 YP_001274504.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 6e-28 41
RoseRS_0114 YP_001274504.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-36 41
RoseRS_0114 YP_001274504.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-35 41
RoseRS_0114 YP_001274504.1 two component transcriptional regulator BAC0125 Protein 2e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RoseRS_0114 YP_001274504.1 two component transcriptional regulator VFG1389 Protein 2e-29 49
RoseRS_0114 YP_001274504.1 two component transcriptional regulator VFG1390 Protein 3e-32 46
RoseRS_0114 YP_001274504.1 two component transcriptional regulator VFG1386 Protein 8e-31 45
RoseRS_0114 YP_001274504.1 two component transcriptional regulator VFG1563 Protein 1e-31 43
RoseRS_0114 YP_001274504.1 two component transcriptional regulator VFG1702 Protein 1e-31 43
RoseRS_0114 YP_001274504.1 two component transcriptional regulator VFG0596 Protein 2e-24 42