
|
Name : ureB (Pput_2845) Accession : YP_001268161.1 Strain : Pseudomonas putida F1 Genome accession: NC_009512 Putative virulence/resistance : Virulence Product : urease subunit beta Function : - COG functional category : E : Amino acid transport and metabolism COG ID : COG0832 EC number : - Position : 3227391 - 3227744 bp Length : 354 bp Strand : - Note : ureases catalyze the hydrolysis of urea into ammonia and carbon dioxide; in Helicobacter pylori and Yersinia enterocolitica the ammonia released plays a key role in bacterial survival by neutralizing acids when colonizing the gastric mucosa; the holoenzym DNA sequence : ATGACCCCATCGTCTGAAACCGCCAAGGAGCGTCGCATGATCCCAGGTGAAATCCAGGTCGCCACGGGCGACATCGAGTT GAACAGTGGCCGAGAAACGGTCAGCGTCAGTGTGGCCAACCATGGCGACCGGCCGGTGCAGGTCGGCTCGCACTACCACT TCTACGAGGTCAACGACGCGCTGGTATTCGACCGTGCGCCAACCCTCGGCTTTCGCCTGGACATCCCGGCCGGCACTGCC GTGCGCTTCGAGCCGGGTCAGGCGCGTACCGTGCAACTGGTGGCGTACGCCGGCAAGCGTGAGGTCTATGGTTTTCAGGG CAAGGTGATGGGCGCGCTGGAGGGCAGGGCATGA Protein sequence : MTPSSETAKERRMIPGEIQVATGDIELNSGRETVSVSVANHGDRPVQVGSHYHFYEVNDALVFDRAPTLGFRLDIPAGTA VRFEPGQARTVQLVAYAGKREVYGFQGKVMGALEGRA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ureB | NP_286679.1 | urease subunit beta | Virulence | TAI | Protein | 3e-27 | 67 |
| ureB | NP_287087.1 | urease subunit beta | Not tested | TAI | Protein | 3e-27 | 67 |
| ureB | YP_005686359.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 3e-26 | 60 |
| ureB | YP_003784326.1 | urease subunit beta | Not tested | PiCp 7 | Protein | 5e-26 | 60 |
| ureB | YP_005682175.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 3e-26 | 60 |
| ureB | YP_005684267.1 | Urease beta subunit | Not tested | PiCp 7 | Protein | 3e-26 | 60 |