Gene Information

Name : Swit_4798 (Swit_4798)
Accession : YP_001265273.1
Strain : Sphingomonas wittichii RW1
Genome accession: NC_009511
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5282888 - 5283580 bp
Length : 693 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence : 
ATGAGCCGGAAGATATTGCTGGTCGAGGATGACGCCGCTACCGCCGACTTCGTCGCGACCGGGCTGTCCGAGCACGGCTT
CGTCGTCGATCGCGCCGACAATGGCCGCGACGGCCTGTTCCACGCCACCGACGGCAGCTACGACTGCGTGATCCTCGACC
GGATGCTGCCGGGCATGGACGGGATGGCGGTGCTCGGCGCGATCCGCGCGGCGGGGATCGAGACGCCGGTGATCATCCTG
TCGGCGCTGGGCGCGGCCGAGGACCGGGTGAAAGGCCTCGAAGGCGGCTCCGACGACTATCTGACCAAGCCCTTCGCCTT
CGCCGAACTGCTCGCGCGGGTCCGTCTGCTGATCCGCCATGGCCAGGGCCGGAGCGCCGCCGCGCCCGAGACCCGGCTGG
CCTGCGACGACCTGGAGATGGACCTGCTGTCGCGCAAGGTGCGGCGCGGCGGCCAGCCGATCGAGTTGCAGCCGCGCGAG
TTCCGCCTGCTCGAATTCCTGCTCCGCCATGCCGAGCAGGTGGTGACGCGGACGATGCTGCTCGAAGGCGTGTGGGACTA
TCATTTCGATCCGGGCACCAACGTCATCGACGTCCATGTCAGCCGGCTGCGCAAGAAGATCGACGAGGGCCAGGCCCGGC
CGCTGCTCCACACGGTGCGTGGATCGGGCTATCGGCTGGGCCTCGACGGTTGA

Protein sequence : 
MSRKILLVEDDAATADFVATGLSEHGFVVDRADNGRDGLFHATDGSYDCVILDRMLPGMDGMAVLGAIRAAGIETPVIIL
SALGAAEDRVKGLEGGSDDYLTKPFAFAELLARVRLLIRHGQGRSAAAPETRLACDDLEMDLLSRKVRRGGQPIELQPRE
FRLLEFLLRHAEQVVTRTMLLEGVWDYHFDPGTNVIDVHVSRLRKKIDEGQARPLLHTVRGSGYRLGLDG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-41 50
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-40 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Swit_4798 YP_001265273.1 two component transcriptional regulator BAC0347 Protein 2e-42 52
Swit_4798 YP_001265273.1 two component transcriptional regulator BAC0111 Protein 1e-44 52
Swit_4798 YP_001265273.1 two component transcriptional regulator BAC0125 Protein 2e-44 50
Swit_4798 YP_001265273.1 two component transcriptional regulator BAC0638 Protein 2e-44 50
Swit_4798 YP_001265273.1 two component transcriptional regulator BAC0083 Protein 7e-42 49
Swit_4798 YP_001265273.1 two component transcriptional regulator BAC0308 Protein 3e-40 46
Swit_4798 YP_001265273.1 two component transcriptional regulator BAC0197 Protein 4e-40 46
Swit_4798 YP_001265273.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Swit_4798 YP_001265273.1 two component transcriptional regulator VFG0596 Protein 1e-41 50
Swit_4798 YP_001265273.1 two component transcriptional regulator VFG1389 Protein 5e-35 44
Swit_4798 YP_001265273.1 two component transcriptional regulator VFG1386 Protein 4e-38 41