Gene Information

Name : Swit_3577 (Swit_3577)
Accession : YP_001264061.1
Strain : Sphingomonas wittichii RW1
Genome accession: NC_009511
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3940000 - 3940698 bp
Length : 699 bp
Strand : +
Note : TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGGCACGTGCCCGGGTACTGCTTGTCGAGGACGACGCGGCGCTCGCCGAATTGGTCAGCTGGCACCTCGAACGCGAGGA
TTTCGAGGTCGAGCGCACCGCCGACGGCGAGGAGGCGATCCTGCTGGCGCGCGAGACCCCGCCCGACCTGGTGCTGCTCG
ACTGGATGATCGAAGGCGTGTCGGGGATCGAGGTCTGCCGCCGCCTGCGCCGGCTGGCCGACACCGCCAACGTGCCGATC
ATCATGCTCACCGCGCGCGGCGAGGAGGAGGATCGCGTGCGCGGCCTCGAAACCGGCGCCGACGACTATGTCACCAAGCC
GTTCAGCCCGCGCGAGCTGGTCGCGCGCGTCGGCGCGGTGCTGCGCCGCGTCCGTCCGGCGCTGGCCGGCGAGCGGCTGT
CCTACGCCGACATCGAGATGGACACCGCCAGCCACCGCGTCCGCCGCGGCGGATCGCCGATCAGCCTGGGGCCGACCGAG
TTCCGGCTGCTCAAGCATTTCCTCGAGCATCCCGGCCGCGTCTTCTCGCGCGAGCGGCTGCTCGATTCGGTCTGGGGCCG
CGACAGCGACATCGAGCCGCGCACCGTCGACGTCCATATCCGGCGCCTGCGCAAGGCGATCAACCTCGCCGACGCGCCCG
ACCTGATCCGCACGGTCCGCTCGGCCGGCTACGCCCTCGACAGCGAGGGCATGGCCTGA

Protein sequence :
MARARVLLVEDDAALAELVSWHLEREDFEVERTADGEEAILLARETPPDLVLLDWMIEGVSGIEVCRRLRRLADTANVPI
IMLTARGEEEDRVRGLETGADDYVTKPFSPRELVARVGAVLRRVRPALAGERLSYADIEMDTASHRVRRGGSPISLGPTE
FRLLKHFLEHPGRVFSRERLLDSVWGRDSDIEPRTVDVHIRRLRKAINLADAPDLIRTVRSAGYALDSEGMA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 3e-22 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-24 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Swit_3577 YP_001264061.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-35 48
Swit_3577 YP_001264061.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-29 43
Swit_3577 YP_001264061.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-29 43
Swit_3577 YP_001264061.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-29 43
Swit_3577 YP_001264061.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-29 43
Swit_3577 YP_001264061.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-29 43
Swit_3577 YP_001264061.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 9e-30 43
Swit_3577 YP_001264061.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-29 43
Swit_3577 YP_001264061.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-29 43
Swit_3577 YP_001264061.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-29 43
Swit_3577 YP_001264061.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-29 43
Swit_3577 YP_001264061.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-28 43
Swit_3577 YP_001264061.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-28 43
Swit_3577 YP_001264061.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 2e-28 43
Swit_3577 YP_001264061.1 two component transcriptional regulator NC_012469.1.7686381. Protein 1e-30 41
Swit_3577 YP_001264061.1 two component transcriptional regulator NC_002695.1.916589.p Protein 2e-28 41
Swit_3577 YP_001264061.1 two component transcriptional regulator BAC0039 Protein 2e-28 41
Swit_3577 YP_001264061.1 two component transcriptional regulator CP000034.1.gene2186. Protein 2e-28 41
Swit_3577 YP_001264061.1 two component transcriptional regulator CP001918.1.gene3444. Protein 7e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Swit_3577 YP_001264061.1 two component transcriptional regulator VFG0596 Protein 3e-24 42
Swit_3577 YP_001264061.1 two component transcriptional regulator VFG1386 Protein 6e-29 42