Gene Information

Name : Swit_3444 (Swit_3444)
Accession : YP_001263928.1
Strain : Sphingomonas wittichii RW1
Genome accession: NC_009511
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3780478 - 3781140 bp
Length : 663 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGCGCGTCCTGATCGTCGAGGATGAACCCAATCTTGGCCGCCAGCTCCGCGCCACGCTCGAAGGCGCCGGCTATGCGGT
CGACCTGGCCACCGACGGCGAGGACGGCCATTTCCTCGGATCGACCGAAAGCTACGACGCGATCATCCTCGACCTGGGCC
TGCCCGAGGTCGACGGGCTGACCGTGCTCGACCGCTGGCGGCGCGAGGGCAAGGACACGCCGGTGCTGGTGCTGACCGCG
CGCGACAGCTGGTCGGACAAGGTCGCCGGGCTCGACGCGGGCGCCGACGACTATCTCGCCAAGCCCTTCCAGACCGAGGA
GCTGATCGCCCGGCTGCGCGCGCTGATCCGCCGCGCCTCGGGCAACGCCTCGTCCGAGCTGATCGCCGGCGATGTCCGGC
TCGACACCCGCAGCGGCAAGGTGACGCTGGCGGGCGAGCCGGTGAAGCTGACCGCGCAGGAGTACAAGCTGCTCAGCTAC
CTGCTCCACCACAAGGGCAAGGTGGTCAGCCGCACCGAGCTGATCGAGCATATCTACGACCAGGATTTCGATCGCGATTC
GAACACGATCGAGGTGTTCGTGACCCGCATCCGCAAGAAGCTGGGCCAGGACGTCATCACCACGATCCGCGGCCTCGGCT
ATTCGCTGGATGACCCTGCTTAG

Protein sequence :
MRVLIVEDEPNLGRQLRATLEGAGYAVDLATDGEDGHFLGSTESYDAIILDLGLPEVDGLTVLDRWRREGKDTPVLVLTA
RDSWSDKVAGLDAGADDYLAKPFQTEELIARLRALIRRASGNASSELIAGDVRLDTRSGKVTLAGEPVKLTAQEYKLLSY
LLHHKGKVVSRTELIEHIYDQDFDRDSNTIEVFVTRIRKKLGQDVITTIRGLGYSLDDPA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-22 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Swit_3444 YP_001263928.1 two component transcriptional regulator BAC0487 Protein 3e-25 46
Swit_3444 YP_001263928.1 two component transcriptional regulator NC_002516.2.879194.p Protein 3e-30 45
Swit_3444 YP_001263928.1 two component transcriptional regulator CP000034.1.gene2022. Protein 2e-31 44
Swit_3444 YP_001263928.1 two component transcriptional regulator CP004022.1.gene1005. Protein 1e-31 44
Swit_3444 YP_001263928.1 two component transcriptional regulator NC_002695.1.913289.p Protein 3e-31 44
Swit_3444 YP_001263928.1 two component transcriptional regulator CP000647.1.gene1136. Protein 5e-32 44
Swit_3444 YP_001263928.1 two component transcriptional regulator CP001918.1.gene2526. Protein 1e-30 44
Swit_3444 YP_001263928.1 two component transcriptional regulator BAC0308 Protein 1e-22 44
Swit_3444 YP_001263928.1 two component transcriptional regulator BAC0197 Protein 2e-26 44
Swit_3444 YP_001263928.1 two component transcriptional regulator BAC0530 Protein 4e-32 44
Swit_3444 YP_001263928.1 two component transcriptional regulator BAC0111 Protein 2e-26 43
Swit_3444 YP_001263928.1 two component transcriptional regulator CP001138.1.gene1939. Protein 1e-31 43
Swit_3444 YP_001263928.1 two component transcriptional regulator BAC0083 Protein 2e-22 42
Swit_3444 YP_001263928.1 two component transcriptional regulator BAC0125 Protein 4e-25 42
Swit_3444 YP_001263928.1 two component transcriptional regulator BAC0638 Protein 5e-18 42
Swit_3444 YP_001263928.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-20 41
Swit_3444 YP_001263928.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-20 41
Swit_3444 YP_001263928.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-20 41
Swit_3444 YP_001263928.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-20 41
Swit_3444 YP_001263928.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-20 41
Swit_3444 YP_001263928.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-20 41
Swit_3444 YP_001263928.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-20 41
Swit_3444 YP_001263928.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-20 41
Swit_3444 YP_001263928.1 two component transcriptional regulator BAC0347 Protein 2e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Swit_3444 YP_001263928.1 two component transcriptional regulator VFG0473 Protein 9e-23 44
Swit_3444 YP_001263928.1 two component transcriptional regulator VFG0475 Protein 1e-31 43
Swit_3444 YP_001263928.1 two component transcriptional regulator VFG1390 Protein 2e-21 41