Gene Information

Name : Swit_1123 (Swit_1123)
Accession : YP_001261627.1
Strain : Sphingomonas wittichii RW1
Genome accession: NC_009511
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1268240 - 1268674 bp
Length : 435 bp
Strand : -
Note : PFAM: regulatory protein, MerR; Transcription regulator MerR, DNA binding

DNA sequence :
ATGGTACGGTTGCAAGGGGTTATGCCGATGGCTGCGGGACTGACGATTTCGGGACTGGCCGGTGCCGGCGGCGTCGGGGT
CGAGACGATCCGCTATTATCAGCGGCGCGGCCTGCTGGCGGAGCCGCGGCGACCGCACGGGTCGGGCATGGCGGGCGGCA
TCCGCCGCTATGGCGCGGAGGACGTCCGCCGGCTGCGCTTCATCCGTTCGGCCCAGGCGGCGGGCTTCACCCTAGGCGAG
ATCGCCGAGCTACTCGCGCTCGACGCGGGGCAGGACCGGCAGCGCGCCCGCGAACTGGCCACGGCGCGGATCGAGGCGAT
CGACGCCGAGATCGCGAAGCTGCAACAGGCGCGCGAGGCGCTGCGCCGCATGGCGGGCGCCTGCGCCTCGACGCAGGAGG
GGCCGTGCCCGATCCTGACCGCCTTCGACGGTTGA

Protein sequence :
MVRLQGVMPMAAGLTISGLAGAGGVGVETIRYYQRRGLLAEPRRPHGSGMAGGIRRYGAEDVRRLRFIRSAQAAGFTLGE
IAELLALDAGQDRQRARELATARIEAIDAEIAKLQQAREALRRMAGACASTQEGPCPILTAFDG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 6e-25 44
merR AGK07083.1 MerR Not tested SGI1 Protein 4e-22 44
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-22 44
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-22 44
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-22 44
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-22 44
merR AGK07025.1 MerR Not tested SGI1 Protein 4e-22 44
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 5e-24 44
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 9e-23 43
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-22 43
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-21 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Swit_1123 YP_001261627.1 MerR family transcriptional regulator BAC0684 Protein 1e-24 47
Swit_1123 YP_001261627.1 MerR family transcriptional regulator BAC0683 Protein 4e-24 45
Swit_1123 YP_001261627.1 MerR family transcriptional regulator BAC0686 Protein 7e-24 45
Swit_1123 YP_001261627.1 MerR family transcriptional regulator BAC0688 Protein 9e-24 44
Swit_1123 YP_001261627.1 MerR family transcriptional regulator BAC0687 Protein 3e-23 44
Swit_1123 YP_001261627.1 MerR family transcriptional regulator BAC0232 Protein 3e-23 44
Swit_1123 YP_001261627.1 MerR family transcriptional regulator BAC0689 Protein 1e-22 44