Name : ureA (BOV_1312) Accession : YP_001259254.1 Strain : Genome accession: NC_009505 Putative virulence/resistance : Virulence Product : urease subunit gamma Function : - COG functional category : E : Amino acid transport and metabolism COG ID : COG0831 EC number : 3.5.1.5 Position : 1322790 - 1323092 bp Length : 303 bp Strand : + Note : UreA, with UreB and UreC, catalyzes the hydrolysis of urea to ammonia and carbon dioxide; nickel metalloenzyme; accessory proteins UreD, UreE, UreF, and UreG are necessary for assembly of the metallocenter DNA sequence : ATGCGCCTAACTCCTCGCGAGTTCGACAAGCTTGTTATTCATATGTTGTCGGACGTGGCCCTGAAGCGCAAGAACAAGGG CCTGAAGCTCAATCACCCTGAGGCGGTTGCCGTTCTCAGTGCCTATGTTCTCGACGGCGCGCGCGAAGGCAAAACCGTCG AAGAGGTGATGGACGGCGCGCGCAGCGTACTCAAGGCAGACGACGTCATGGATGGCGTTCCCGATCTTCTGCCGCTCATC CAGGTAGAGGCCGTGTTTAGCGACGGCAGCCGCCTCGTCAGTCTTCATAATCCAATTACGTGA Protein sequence : MRLTPREFDKLVIHMLSDVALKRKNKGLKLNHPEAVAVLSAYVLDGAREGKTVEEVMDGARSVLKADDVMDGVPDLLPLI QVEAVFSDGSRLVSLHNPIT |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ureA | YP_005686360.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 1e-24 | 56 |
ureA | YP_005682176.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 1e-24 | 56 |
ureA | YP_005684268.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 1e-24 | 56 |
ureA | YP_003784327.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 1e-24 | 56 |
ureA | NP_286678.1 | urease subunit gamma | Virulence | TAI | Protein | 1e-21 | 53 |
ureA | NP_287086.1 | urease subunit gamma | Not tested | TAI | Protein | 1e-21 | 53 |