Gene Information

Name : CBO1968 (CBO1968)
Accession : YP_001254471.1
Strain : Clostridium botulinum ATCC 3502
Genome accession: NC_009495
Putative virulence/resistance : Resistance
Product : DNA-binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2101489 - 2102154 bp
Length : 666 bp
Strand : -
Note : -

DNA sequence :
ATGCCAAAGAGAATTCTTGTAGTAGAGGACGATTTTGATATACATACTATTATAAGTGAGGTTCTAAAGGAAAGTGGATA
TTTAGTGGAGGTGGCTACAGATGGATTAATTGCGGTGGAGATGTTTAGAAGGGGGAATTTTGATTTAATAATTTTAGATG
TGATGCTTCCTAAAATAGATGGATTTGTAGTATGTGAAATTATAAGAAAAGAATCAAGTATGCCTATAATAATGCTTACT
GCTCTAGGAGAAGAGGAGGATGAGATGAAAGGTTTTGAATTAAAAGTAGATGATTATATAACAAAACCCTTTTCTATTAA
TTTATTAATAAAAAGAGTAGAAGCAGTACTTAGAAGAGCCAATGGATTAGAGGAAAATAATTCAACTTTAACCTTTGAAG
AAATAACAATATATCCTTCTAATTATAAAACTTTAGTTAATAATAAGGAAATAGAACTAACTTATAAAGAATTTCAGATA
TTAGAAATATTAATATCAAATGTAGGAAGGGTCTTTTCTAGAGAATCTTTATTAAATCAAATATGGGGATATGATTATTT
TGGAGATACCCGTGTTATAGATACTCATATCAAAAATTTAAGACAAAAACTAAACATAGATTATATAAAGACCATAAGGG
GAGTGGGGTATAAAATTGAGAAATAA

Protein sequence :
MPKRILVVEDDFDIHTIISEVLKESGYLVEVATDGLIAVEMFRRGNFDLIILDVMLPKIDGFVVCEIIRKESSMPIIMLT
ALGEEEDEMKGFELKVDDYITKPFSINLLIKRVEAVLRRANGLEENNSTLTFEEITIYPSNYKTLVNNKEIELTYKEFQI
LEILISNVGRVFSRESLLNQIWGYDYFGDTRVIDTHIKNLRQKLNIDYIKTIRGVGYKIEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 7e-44 44
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-43 44
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 4e-43 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CBO1968 YP_001254471.1 DNA-binding response regulator HE999704.1.gene1202. Protein 4e-48 47
CBO1968 YP_001254471.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 7e-39 45
CBO1968 YP_001254471.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 7e-39 45
CBO1968 YP_001254471.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 7e-39 45
CBO1968 YP_001254471.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 7e-39 45
CBO1968 YP_001254471.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 7e-39 45
CBO1968 YP_001254471.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 7e-39 45
CBO1968 YP_001254471.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 7e-39 45
CBO1968 YP_001254471.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 7e-39 45
CBO1968 YP_001254471.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 7e-39 45
CBO1968 YP_001254471.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 7e-39 45
CBO1968 YP_001254471.1 DNA-binding response regulator AF310956.2.orf0.gene Protein 3e-44 44
CBO1968 YP_001254471.1 DNA-binding response regulator U35369.1.gene1.p01 Protein 7e-44 44
CBO1968 YP_001254471.1 DNA-binding response regulator AE016830.1.gene2255. Protein 7e-44 44
CBO1968 YP_001254471.1 DNA-binding response regulator NC_012469.1.7685629. Protein 3e-37 43
CBO1968 YP_001254471.1 DNA-binding response regulator HE999704.1.gene2815. Protein 7e-38 41