Gene Information

Name : SaurJH9_0047 (SaurJH9_0047)
Accession : YP_001245435.1
Strain : Staphylococcus aureus JH9
Genome accession: NC_009487
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 56203 - 56553 bp
Length : 351 bp
Strand : -
Note : PFAM: protein of unknown function DUF950

DNA sequence :
ATGAAAACGACCACTCAAGAACTCAAACAATATATAACTCGTCTATTCCAACTATCTAACAATGAAACATGGGAATGCGA
AGCGTTAGAAGAAGCAGCAGAAAATATTCTACCGGAACGTTTTATTAATGATTCCCCACTTGCACATCTTACACTTGAAA
CTTATACCTACTACAATAATGAACTACATGACCTAAGTATCTATCCATTTCTTATGTACGCTAATAACCAACTCATCAGC
GTTGGTTATCTGAATCATTTTGACATGGACTTTTTATATCTCACAGATACTAAAAATACGATTATCGATGAACGTCATTT
ACTAAGAGAAGGAGGGACTCACCATGAATAA

Protein sequence :
MKTTTQELKQYITRLFQLSNNETWECEALEEAAENILPERFINDSPLAHLTLETYTYYNNELHDLSIYPFLMYANNQLIS
VGYLNHFDMDFLYLTDTKNTIIDERHLLREGGTHHE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAR0058 YP_039529.1 hypothetical protein Not tested Type-II SCCmec Protein 5e-49 100
SA0056 NP_373296.1 hypothetical protein Not tested Type-II SCCmec Protein 5e-49 100
unnamed BAA94661.1 - Not tested Type-II SCCmec Protein 4e-49 100
SERP2501 YP_190043.1 hypothetical protein Not tested Type-II SCCmec Protein 5e-49 100
SAV0060 NP_370584.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-48 99
SAS0031 YP_042164.1 hypothetical protein Not tested SCC476 Protein 2e-39 91
SE0055 NP_763610.1 hypothetical protein Not tested SCCpbp4 Protein 7e-41 90
unnamed BAC67562.1 hypothetical protein Not tested Type-IVc SCCmec Protein 2e-38 89
unnamed BAA94329.1 hypothetical protein Not tested Type-I SCCmec Protein 1e-41 89
SAMSHR1132_00390 YP_005324562.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 3e-38 89
MW0037 NP_644852.1 hypothetical protein Not tested Type-IV SCCmec Protein 3e-38 89
unnamed BAB72110.1 hypothetical protein Not tested Type-IVa SCCmec Protein 2e-38 89
unnamed BAB72129.1 hypothetical protein Not tested Type-IVb SCCmec Protein 2e-38 89
SACOL0040 YP_184951.1 hypothetical protein Not tested Type-I SCCmec Protein 2e-41 89
unnamed BAB83488.1 - Not tested SCC 12263 Protein 3e-46 88
SE0033 NP_763588.1 hypothetical protein Not tested SCCpbp4 Protein 1e-37 87
SH0057 YP_251972.1 hypothetical protein Not tested SCCmec Protein 3e-30 54
SAPIG0051 YP_005732861.1 hypothetical protein Not tested Type-V SCCmec Protein 3e-30 54
unnamed BAD24835.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-30 54
unnamed ACL99845.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-30 53
unnamed BAG06213.1 hypothetical protein Not tested Type-VII SCCmec Protein 1e-30 53
unnamed BAB46981.2 hypothetical protein Not tested Type-IIIinv SCCmec Protein 3e-28 52
unnamed BAB47671.1 hypothetical protein Not tested Type-III SCCmec Protein 2e-24 50
unnamed BAC53833.1 hypothetical protein Not tested SRImec-III and SCCmec-III region Protein 2e-24 50
unnamed BAB47598.1 hypothetical protein Not tested Type-III SCCmec Protein 3e-26 49
unnamed AAL26663.1 unknown Not tested SCCcap1 Protein 8e-26 49
SARLGA251_00350 YP_005754050.1 hypothetical protein Not tested Type-XI SCCmec Protein 2e-24 48
unnamed ACL99833.1 hypothetical protein Not tested Type-V SCCmec Protein 2e-25 48
unnamed BAG06192.1 hypothetical protein Not tested Type-VII SCCmec Protein 2e-25 48
SSP0047 YP_300137.1 hypothetical protein Not tested SCC15305cap Protein 2e-24 48
SSP0034 YP_300124.1 hypothetical protein Not tested SCC15305RM Protein 4e-25 47