Gene Information

Name : Tpet_1136 (Tpet_1136)
Accession : YP_001244726.1
Strain : Thermotoga petrophila RKU-1
Genome accession: NC_009486
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1158457 - 1159176 bp
Length : 720 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGGCGAAAAAGAAGATTCTGGTGGTTGACGACGACCCGGCAATTCTCGAGCTGGTAGGATACAACCTTTCCAAAGAAGG
ATACGAGGTGCTCAAGGCTTACGATGGAGAAGAAGCACTCAAAATTGCCAACGACGAGGATGTGGATATGTTCATAGTGG
ATATCATGCTTCCTGGAATTGACGGTTTCGAGCTGGTCAGGAAGATCAGGGCTATAGAGAAATACAAGAACACCCCCGTG
ATCTTCCTGAGCGCGAAGGGAGAAGAATTCGACAAGGTGCTTGGGCTGGAGCTCGGTGCGGACGACTACATCACCAAGCC
GTTCAGCGTGAGAGAGCTTCTTGCGAGGGTGAAGGCTATATTCAGAAGGCTTTCCACCGCTACTCAGAGCAAGGAAGAAA
GGCCTAAGAAGATCATAGCCAAGGATCTTGAAATCGATGTGGAAAAGTACGAAGTGAAAGTGAGAGGGAAAAAAGTGAAC
CTCACTCCTCTCGAATTTGAACTGCTCCGATTCCTCGCGGAAAACGAAGGAAAAGTTTTCAGCAGGGATGTTCTCCTTGA
TAAACTCTGGGGATACGATTATTACGGAGATACGAGAACTGTAGATGTTCACATAAGAAGGCTGAGAACGAAGATAGAAG
AAGATCCTTCGAATCCGAAATACATAATCACTGTGAGAGGAAAGGGATACAAATTCAGGGATCCCGGAAAGGAAGACTGA

Protein sequence :
MAKKKILVVDDDPAILELVGYNLSKEGYEVLKAYDGEEALKIANDEDVDMFIVDIMLPGIDGFELVRKIRAIEKYKNTPV
IFLSAKGEEFDKVLGLELGADDYITKPFSVRELLARVKAIFRRLSTATQSKEERPKKIIAKDLEIDVEKYEVKVRGKKVN
LTPLEFELLRFLAENEGKVFSRDVLLDKLWGYDYYGDTRTVDVHIRRLRTKIEEDPSNPKYIITVRGKGYKFRDPGKED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-43 47
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-44 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_012469.1.7685629. Protein 3e-54 52
Tpet_1136 YP_001244726.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-49 51
Tpet_1136 YP_001244726.1 two component transcriptional regulator AE016830.1.gene1681. Protein 5e-54 49
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_012469.1.7686381. Protein 1e-46 48
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-49 48
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-49 48
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-49 48
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-49 48
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-49 48
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-49 48
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-49 48
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-49 48
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-49 48
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-49 48
Tpet_1136 YP_001244726.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-46 47
Tpet_1136 YP_001244726.1 two component transcriptional regulator AM180355.1.gene1830. Protein 6e-42 46
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 3e-45 45
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 3e-45 45
Tpet_1136 YP_001244726.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-40 44
Tpet_1136 YP_001244726.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 7e-44 43
Tpet_1136 YP_001244726.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 3e-41 43
Tpet_1136 YP_001244726.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 5e-38 43
Tpet_1136 YP_001244726.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 2e-38 43
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-36 41
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-36 41
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-36 41
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-36 41
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-36 41
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-36 41
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-36 41
Tpet_1136 YP_001244726.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-36 41
Tpet_1136 YP_001244726.1 two component transcriptional regulator BAC0125 Protein 5e-34 41
Tpet_1136 YP_001244726.1 two component transcriptional regulator CP001581.1.gene280.p Protein 1e-33 41
Tpet_1136 YP_001244726.1 two component transcriptional regulator BAC0197 Protein 2e-33 41
Tpet_1136 YP_001244726.1 two component transcriptional regulator EU250284.1.orf4.gene Protein 4e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tpet_1136 YP_001244726.1 two component transcriptional regulator VFG1563 Protein 9e-44 47
Tpet_1136 YP_001244726.1 two component transcriptional regulator VFG1702 Protein 4e-44 47
Tpet_1136 YP_001244726.1 two component transcriptional regulator VFG1389 Protein 3e-33 43
Tpet_1136 YP_001244726.1 two component transcriptional regulator VFG1386 Protein 2e-38 41