Gene Information

Name : phoB (BBta_1991)
Accession : YP_001238088.1
Strain : Bradyrhizobium sp. BTAi1
Genome accession: NC_009485
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2057150 - 2057857 bp
Length : 708 bp
Strand : +
Note : Evidence: Function of homologous gene experimentally demonstrated in an other organism; Localization: 2 : Cytoplasmic

DNA sequence :
ATGACTGCGCGCATCCTGGTGGTGGAAGATGAAGAGGCGCTGACCACGCTCCTGCGCTATAATCTGGAGACCGAGGGCTA
CGAGGTCGAGACCGTGGGGCGGGGCGACGAGGCCGACACGCGGCTGAAGGAGCGCGTTCCCGATCTCGTGGTGCTCGACT
GGATGCTGCCGGGCCTGTCCGGCATCGAACTGTGCCGCCGGTTGCGGACGCGGCCCGAGACCAAGCAGCTGCCGATCATC
ATGCTGACGGCGCGCGGCGAGGAGAGCGAGCGCGTGCGCGGCCTGGCGACCGGGGCGGACGACTATATCGTCAAGCCGTT
CTCGGTCCCTGAGCTGCTGGCGCGGGTGAAGGGTCTGCTGCGGCGGGCGAGCCCGGAGCGGCTGGCGACGGTGCTGTCCT
ATGGGGACATCGAGCTCGACCGCGAGAAGCGCCGGGTGGCGCGCTCGGGCCGGCCGATCGATCTCGGCCCGACCGAATAC
CGCCTGCTCGAATTCTTCCTCGAGCATCCGGGCCGCGTGTTCAGCCGTGAGCAGTTGCTCGACAGCGTCTGGGGCCGGGA
TATCTATATCGACGAGCGCACGGTGGACGTCCATATCGGCCGCCTGCGCAAGCTGCTCAATCCCGGCCGCGAGCAGGATC
CGATCCGCACGGTGCGCGGCGCCGGCTATGCGCTCGACGACCGCTTCGCCAAGAGCGAGCAGGCGTAA

Protein sequence :
MTARILVVEDEEALTTLLRYNLETEGYEVETVGRGDEADTRLKERVPDLVVLDWMLPGLSGIELCRRLRTRPETKQLPII
MLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLLRRASPERLATVLSYGDIELDREKRRVARSGRPIDLGPTEY
RLLEFFLEHPGRVFSREQLLDSVWGRDIYIDERTVDVHIGRLRKLLNPGREQDPIRTVRGAGYALDDRFAKSEQA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-34 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-35 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_001238088.1 two component transcriptional regulator AE000516.2.gene3505. Protein 8e-36 45
phoB YP_001238088.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-42 44
phoB YP_001238088.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-42 44
phoB YP_001238088.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-42 44
phoB YP_001238088.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-42 44
phoB YP_001238088.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-42 44
phoB YP_001238088.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-42 44
phoB YP_001238088.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-42 44
phoB YP_001238088.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-42 44
phoB YP_001238088.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-42 44
phoB YP_001238088.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-42 44
phoB YP_001238088.1 two component transcriptional regulator HE999704.1.gene1528. Protein 6e-31 42
phoB YP_001238088.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 8e-37 42
phoB YP_001238088.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-37 42
phoB YP_001238088.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-37 42
phoB YP_001238088.1 two component transcriptional regulator CP000034.1.gene2186. Protein 9e-35 42
phoB YP_001238088.1 two component transcriptional regulator CP001918.1.gene3444. Protein 8e-35 42
phoB YP_001238088.1 two component transcriptional regulator CP000647.1.gene2531. Protein 5e-35 42
phoB YP_001238088.1 two component transcriptional regulator BAC0596 Protein 1e-34 42
phoB YP_001238088.1 two component transcriptional regulator BAC0039 Protein 9e-35 42
phoB YP_001238088.1 two component transcriptional regulator NC_002695.1.916589.p Protein 6e-35 42
phoB YP_001238088.1 two component transcriptional regulator CP001138.1.gene2239. Protein 1e-34 42
phoB YP_001238088.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_001238088.1 two component transcriptional regulator VFG1390 Protein 1e-38 45
phoB YP_001238088.1 two component transcriptional regulator VFG1563 Protein 6e-35 43
phoB YP_001238088.1 two component transcriptional regulator VFG1702 Protein 2e-35 43
phoB YP_001238088.1 two component transcriptional regulator VFG1389 Protein 9e-30 42