Gene Information

Name : BBta_1583 (BBta_1583)
Accession : YP_001237703.1
Strain : Bradyrhizobium sp. BTAi1
Genome accession: NC_009485
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 1661592 - 1661939 bp
Length : 348 bp
Strand : +
Note : IS66 Orf2 like domain; Evidence: Similar to previously reported genes of unknown function

DNA sequence :
ATGATCCCGATCCCGACGGGCGTGCGAGTGTGGCTGGCGACGGGCCATACCGACATGCGGTGCGGCTTTCCGAGCCTGGC
TCTGCGCGTGCAGGAAGTGCTCAAGCGCGACGCCATGGGCGGCGGTCTTTTCTGCTTCAGGGGCAAACGCGGTGATCTTT
TGAAGGTCATTTGGCACGATGGTCAGGGAGCATGCCTGTTTACCAAAAGACTCGAGAGAGGCAGGTTCATCTGGCCGTCG
GTCGCCGGTGAAGCGGTGACGATCTCTCCGGCGCAGCTCTCCTATCTGCTGTCCGGGATCGATTGGCGCAATCCTCAGGA
AACCCAGCGCCCGACGCGGGTCGGATAG

Protein sequence :
MIPIPTGVRVWLATGHTDMRCGFPSLALRVQEVLKRDAMGGGLFCFRGKRGDLLKVIWHDGQGACLFTKRLERGRFIWPS
VAGEAVTISPAQLSYLLSGIDWRNPQETQRPTRVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-27 58
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 7e-31 58
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 7e-31 58
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 7e-31 58
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 9e-28 56
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 9e-28 56
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-27 55
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-27 55
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-27 55
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-27 55
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-27 55
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-26 55
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-27 55
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-26 55
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-27 55
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-27 55
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-29 54
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-29 54
unnamed AAL08461.1 unknown Not tested SRL Protein 4e-27 54
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 8e-21 53
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 3e-27 51
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 3e-27 51
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 7e-26 50
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 7e-26 50
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-27 49
tnpB AEZ06052.1 transposition helper protein Not tested Tn6167 Protein 4e-08 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BBta_1583 YP_001237703.1 hypothetical protein VFG1665 Protein 3e-31 58
BBta_1583 YP_001237703.1 hypothetical protein VFG1698 Protein 2e-28 56
BBta_1583 YP_001237703.1 hypothetical protein VFG1709 Protein 1e-27 55
BBta_1583 YP_001237703.1 hypothetical protein VFG0792 Protein 1e-27 55
BBta_1583 YP_001237703.1 hypothetical protein VFG1052 Protein 2e-27 54
BBta_1583 YP_001237703.1 hypothetical protein VFG1517 Protein 3e-21 53
BBta_1583 YP_001237703.1 hypothetical protein VFG1737 Protein 1e-27 49