Gene Information

Name : Gura_4293 (Gura_4293)
Accession : YP_001233009.1
Strain : Geobacter uraniireducens Rf4
Genome accession: NC_009483
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4956150 - 4956824 bp
Length : 675 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGAGAATTCTGGTAGTGGAAGATGAGAAAAAAGTATTGAGTTTCATCAAGCGCGGTTTGGAAGAAGAACAATATGAAGT
CCTTACGGCAAGTGACGGCGAGGAAGGATTAAAAATGGCGCTTGATATGCCATATGATCTGATCATACTCGACTGGATGC
TTCCCAAGCAGGATGGCCTTAGTGTGCTCAAGGAGCTGAGGAACCAAAAAAACGCAACCCCGGTTTTGATGCTGACCGCC
AAGGATTCGGTTGAAGACATCGTGGCCGGCCTCGATTCCGGTTCGGACGATTATCTGACCAAGCCTTTCGCCTTTGCCGA
ACTTCTCGCCAGGGTCAGGGCACTGCTGCGCAGGAGCGAACAGGACCGGGGCGCCGAAATACGTTTCAGCGACCTGCGTC
TTGACCCGGTAACCCACAAGGTATGGCGCAAAGACAAGGAGATTGATCTCACCGCCAAGGAATATGGGCTGCTTGAATAC
TTCATGCGCAACCCGCACGAAGTTTTGACCCGAACCATGATTGCCGAACACGTCTGGGATTACACCTTCGACAGCTTTAC
CAACATCATTGATGTTTATGTCAATTACCTGCGTAAGAAGATCGACCGTGATGCCGACAAAAAGCTGATCCACACTGTCC
GAGGGGTTGGTTACATCCTGAAAGAGGAGGATTGA

Protein sequence :
MRILVVEDEKKVLSFIKRGLEEEQYEVLTASDGEEGLKMALDMPYDLIILDWMLPKQDGLSVLKELRNQKNATPVLMLTA
KDSVEDIVAGLDSGSDDYLTKPFAFAELLARVRALLRRSEQDRGAEIRFSDLRLDPVTHKVWRKDKEIDLTAKEYGLLEY
FMRNPHEVLTRTMIAEHVWDYTFDSFTNIIDVYVNYLRKKIDRDADKKLIHTVRGVGYILKEED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-33 48
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-32 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gura_4293 YP_001233009.1 two component transcriptional regulator BAC0111 Protein 2e-39 51
Gura_4293 YP_001233009.1 two component transcriptional regulator BAC0308 Protein 1e-36 51
Gura_4293 YP_001233009.1 two component transcriptional regulator BAC0125 Protein 6e-40 50
Gura_4293 YP_001233009.1 two component transcriptional regulator BAC0638 Protein 3e-32 50
Gura_4293 YP_001233009.1 two component transcriptional regulator BAC0197 Protein 8e-35 50
Gura_4293 YP_001233009.1 two component transcriptional regulator BAC0347 Protein 7e-34 48
Gura_4293 YP_001233009.1 two component transcriptional regulator BAC0083 Protein 4e-38 48
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-32 45
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-32 45
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-32 45
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-32 45
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-32 45
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-32 45
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-32 45
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-32 45
Gura_4293 YP_001233009.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-28 45
Gura_4293 YP_001233009.1 two component transcriptional regulator HE999704.1.gene1528. Protein 6e-36 44
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-32 43
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-32 43
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-32 43
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-32 43
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-32 43
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-32 43
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-32 43
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-32 43
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-32 43
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-32 43
Gura_4293 YP_001233009.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-30 42
Gura_4293 YP_001233009.1 two component transcriptional regulator NC_012469.1.7685629. Protein 5e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gura_4293 YP_001233009.1 two component transcriptional regulator VFG1390 Protein 6e-45 52
Gura_4293 YP_001233009.1 two component transcriptional regulator VFG0596 Protein 9e-34 48
Gura_4293 YP_001233009.1 two component transcriptional regulator VFG1386 Protein 1e-41 42
Gura_4293 YP_001233009.1 two component transcriptional regulator VFG1389 Protein 1e-33 41