Gene Information

Name : Gura_2556 (Gura_2556)
Accession : YP_001231307.1
Strain : Geobacter uraniireducens Rf4
Genome accession: NC_009483
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2960683 - 2961360 bp
Length : 678 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGAAGACCATACTCGTGATCGAAGACGAAAAGGACCTGGCGGAACTGATAGCCTTCAACCTGGAAAAGGAAGGATACCG
GCCGCTCATCGCCCTTGATGGGATTTCCGGCCTGGAAGCCGTGCGCAGCAATCCTCCCGACCTCATTCTCCTGGATCTGA
TGCTCCCCGGCTTATTAGGAACCGAGATCTGCAAACTCCTGAAGAAGAATGAAAAAACCGCCGCCATTCCGATCATCATG
CTAACAGCCAAGGGTGAGGAGATAGACCGGGTCGTCGGTTTTGAAGTGGGCGCGGACGATTACATGGTGAAACCTTTCTC
CACCCGGGAGCTGCTGCTGCGGGTCAAGGCGGTGCTGCGCCGCACCATGCCGGAAAAAACAGCAGAAAAGCGCATCACCA
TCGGCCTCGTCACCATCGACACCGAACGCCACCTGGTCAACGTTGCCGGTGAAGAGATTATCCTCACGACCACCGAATTC
AAGCTGCTCCTTAACCTGGCCGAACGCCTGGGGCGTGTGCAGAGCCGTGACATCCTGCTGCAAAACGTCTGGGGATACAA
TTACGTGGGGGACAGCCGGACGGTGGATACCCATGTGACAAGGCTCAGGACCAAACTCGGCGAGGCGGGAGAAATGATCA
AGACCGTGCGCGGTTTCGGCTACAAGATGGAGGAATAA

Protein sequence :
MKTILVIEDEKDLAELIAFNLEKEGYRPLIALDGISGLEAVRSNPPDLILLDLMLPGLLGTEICKLLKKNEKTAAIPIIM
LTAKGEEIDRVVGFEVGADDYMVKPFSTRELLLRVKAVLRRTMPEKTAEKRITIGLVTIDTERHLVNVAGEEIILTTTEF
KLLLNLAERLGRVQSRDILLQNVWGYNYVGDSRTVDTHVTRLRTKLGEAGEMIKTVRGFGYKMEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-23 42
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 7e-26 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-41 49
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-41 49
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-41 49
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-41 49
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-41 49
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-41 49
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-41 49
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-41 49
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-41 48
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-41 48
Gura_2556 YP_001231307.1 two component transcriptional regulator HE999704.1.gene2815. Protein 7e-37 47
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-37 46
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-31 44
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-31 44
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-31 44
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-31 44
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-31 44
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-31 44
Gura_2556 YP_001231307.1 two component transcriptional regulator AE015929.1.gene1106. Protein 3e-26 44
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-31 44
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-31 44
Gura_2556 YP_001231307.1 two component transcriptional regulator HE999704.1.gene1528. Protein 2e-26 43
Gura_2556 YP_001231307.1 two component transcriptional regulator AE016830.1.gene1681. Protein 1e-37 43
Gura_2556 YP_001231307.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-31 43
Gura_2556 YP_001231307.1 two component transcriptional regulator CP001918.1.gene5135. Protein 2e-23 43
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_012469.1.7686381. Protein 3e-36 42
Gura_2556 YP_001231307.1 two component transcriptional regulator BAC0039 Protein 8e-26 42
Gura_2556 YP_001231307.1 two component transcriptional regulator CP001138.1.gene2239. Protein 9e-26 42
Gura_2556 YP_001231307.1 two component transcriptional regulator CP000034.1.gene2186. Protein 8e-26 42
Gura_2556 YP_001231307.1 two component transcriptional regulator NC_002695.1.916589.p Protein 7e-26 42
Gura_2556 YP_001231307.1 two component transcriptional regulator BAC0596 Protein 9e-26 42
Gura_2556 YP_001231307.1 two component transcriptional regulator AF310956.2.orf0.gene Protein 3e-26 41
Gura_2556 YP_001231307.1 two component transcriptional regulator U35369.1.gene1.p01 Protein 4e-26 41
Gura_2556 YP_001231307.1 two component transcriptional regulator AE016830.1.gene2255. Protein 4e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gura_2556 YP_001231307.1 two component transcriptional regulator VFG0596 Protein 2e-23 42