Gene Information

Name : Gura_1986 (Gura_1986)
Accession : YP_001230749.1
Strain : Geobacter uraniireducens Rf4
Genome accession: NC_009483
Putative virulence/resistance : Resistance
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2300340 - 2301011 bp
Length : 672 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGCGCATTTTAGTCGTTGAGGATGAAATTAAAACATCCGCCTTCCTGCGAAAGGGGCTGCGCGAAAGCGGATTCACCGT
TGACGTTGCCAATGATGGCGAAGAAGGGCTCGATCTTGCTCTGAGCAGGGAGTACGACCTGATCATTCTCGATGTCATGC
TTCCGGGGGTCGATGGATGGCAGATAATCAAGAGAATCCGCGGCACAAAGCGGGATACGCCTGTTCTTTTCCTGACGGCA
CGGGATGCTGTACAAGATCGAATCAAGGGGCTGGAGTTGGGCGCAGATGATTATCTGGTCAAACCTTTTGCATTCTCCGA
ATTACTTGCCCGCATACGCACCATACTCCGCCGCGGCCCGGTGAGAACCCTGGAGCTGATTCGCATAGCGGATCTTGAAA
TCGATTTGATGGGTCATAGGGTGATGCGGGGGGGGAAACGGCTCGACTTGACCCCAAAAGAATTTGCCCTCCTTTCTCTC
CTTGCACGGCGGACAGGGGAGGTCCTTACCAGGACCCGCATTGCGGAACGAATCTGGGATATCGATTTTGAAAGCGATAC
GAATGTTGTCGATGTGCATATGCGCCGTCTCCGGGCAAAAGTCGATGATCCGTTCGAGCATAAACTGATTCATACCGTCC
GTGGGGTGGGATATGTTCTCGAAGAGCGATAA

Protein sequence :
MRILVVEDEIKTSAFLRKGLRESGFTVDVANDGEEGLDLALSREYDLIILDVMLPGVDGWQIIKRIRGTKRDTPVLFLTA
RDAVQDRIKGLELGADDYLVKPFAFSELLARIRTILRRGPVRTLELIRIADLEIDLMGHRVMRGGKRLDLTPKEFALLSL
LARRTGEVLTRTRIAERIWDIDFESDTNVVDVHMRRLRAKVDDPFEHKLIHTVRGVGYVLEER

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-59 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-58 56
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator BAC0125 Protein 1e-71 65
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator BAC0197 Protein 3e-65 64
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator BAC0083 Protein 3e-68 61
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator BAC0638 Protein 2e-61 60
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator BAC0308 Protein 2e-63 58
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator BAC0111 Protein 2e-65 56
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator BAC0347 Protein 5e-60 55
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 2e-44 46
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 2e-44 46
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 2e-44 46
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 2e-44 46
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 2e-44 46
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 2e-44 46
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 5e-39 46
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 2e-44 46
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 2e-44 46
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 3e-37 45
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 2e-37 45
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 2e-37 45
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 2e-37 45
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 2e-37 45
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 3e-37 45
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 2e-37 45
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 3e-37 45
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 2e-37 45
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 2e-37 45
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator AE016830.1.gene1681. Protein 4e-40 44
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 6e-33 44
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 4e-33 43
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator HE999704.1.gene2815. Protein 3e-38 43
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_012469.1.7685629. Protein 5e-34 42
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator AF310956.2.orf0.gene Protein 6e-36 41
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator NC_012469.1.7686381. Protein 5e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator VFG0596 Protein 7e-60 57
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator VFG1390 Protein 4e-44 47
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator VFG1389 Protein 2e-38 46
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator VFG1386 Protein 4e-41 45
Gura_1986 YP_001230749.1 two component heavy metal response transcriptional regulator VFG0473 Protein 6e-32 43