Gene Information

Name : SynRCC307_0250 (SynRCC307_0250)
Accession : YP_001226506.1
Strain : Synechococcus sp. RCC307
Genome accession: NC_009482
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 248067 - 248825 bp
Length : 759 bp
Strand : -
Note : Signal transduction mechanisms / Transcription

DNA sequence :
ATGGCGGTTGCTGCCCCAGCCCACAACGGCAAGGAGACCATCCTTGTGGTGGATGACGAGGCCAGCATCCGGCGGATCCT
CGAGACCAGGCTCTCGATGATTGGCTACAACGTCGTGACGGCGGCCGATGGCGAAGAGGCCCTCGAAGCGTTCCACCGCG
AGCCCACCGATCTGGTGGTGCTCGACGTGATGATGCCCAAGCTCGATGGCTATGGCGTCTGCCAAGAGCTACGCAAGGAA
TCGGACGTGCCGATCGTGATGCTCACTGCCCTCGGTGATGTGGCCGACCGCATCACGGGCCTGGAGCTCGGCGCCGATGA
CTACGTCGTGAAGCCCTTTAGCCCTAAGGAACTCGAAGCGCGCATTCGCTGCGTCCTGCGCCGCGTTGAGAAAGAGCACG
GCGGCGGCTCGATCCCCAACTCGGGCGTGATCCAGGTGAGCGATCTCAAGATCGACACCAACAAGCGCCAGGTGTACCGG
GCTGGTGAGCGCATCCGCCTGACCGGAATGGAATTCAGCCTGCTGGAGCTGCTGGTGAGCCGCTCGGGTGAACCGTTTAG
CCGCGGCGAAATCCTCAAGGATGTTTGGGGTTACACCCCTGAGCGTCATGTGGACACCCGGGTGGTGGATGTGCACATCT
CGCGGCTGCGCTCCAAGCTCGAAGACGATCCTGCCAACCCCGAATTGATCCTCACCGCTCGGGGCACGGGTTACCTTTTT
CAGCGGATCATTGACGGCGCCACTGGCGAAGGAGCCTGA

Protein sequence :
MAVAAPAHNGKETILVVDDEASIRRILETRLSMIGYNVVTAADGEEALEAFHREPTDLVVLDVMMPKLDGYGVCQELRKE
SDVPIVMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRCVLRRVEKEHGGGSIPNSGVIQVSDLKIDTNKRQVYR
AGERIRLTGMEFSLLELLVSRSGEPFSRGEILKDVWGYTPERHVDTRVVDVHISRLRSKLEDDPANPELILTARGTGYLF
QRIIDGATGEGA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-31 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_002952.2859905.p0 Protein 1e-45 48
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_009641.5332272.p0 Protein 2e-45 48
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_013450.8614421.p0 Protein 2e-45 48
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_007793.3914279.p0 Protein 2e-45 48
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_002745.1124361.p0 Protein 2e-45 48
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_009782.5559369.p0 Protein 2e-45 48
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_002951.3237708.p0 Protein 2e-45 48
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_007622.3794472.p0 Protein 1e-45 48
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_002758.1121668.p0 Protein 2e-45 48
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_003923.1003749.p0 Protein 2e-45 47
SynRCC307_0250 YP_001226506.1 two-component system response regulator AE000516.2.gene3505. Protein 7e-41 47
SynRCC307_0250 YP_001226506.1 two-component system response regulator BAC0125 Protein 3e-38 46
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_012469.1.7685629. Protein 6e-43 46
SynRCC307_0250 YP_001226506.1 two-component system response regulator HE999704.1.gene2815. Protein 8e-41 46
SynRCC307_0250 YP_001226506.1 two-component system response regulator BAC0083 Protein 3e-37 44
SynRCC307_0250 YP_001226506.1 two-component system response regulator BAC0197 Protein 4e-36 44
SynRCC307_0250 YP_001226506.1 two-component system response regulator CP000034.1.gene3671. Protein 3e-41 44
SynRCC307_0250 YP_001226506.1 two-component system response regulator BAC0638 Protein 2e-30 43
SynRCC307_0250 YP_001226506.1 two-component system response regulator CP001918.1.gene5135. Protein 1e-26 42
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_012469.1.7686381. Protein 3e-41 42
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_013450.8614146.p0 Protein 2e-36 41
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_002951.3238224.p0 Protein 2e-36 41
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_007793.3914065.p0 Protein 2e-36 41
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_002758.1121390.p0 Protein 2e-36 41
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_010079.5776364.p0 Protein 2e-36 41
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_002952.2859858.p0 Protein 2e-36 41
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_007622.3794948.p0 Protein 2e-36 41
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_003923.1003417.p0 Protein 2e-36 41
SynRCC307_0250 YP_001226506.1 two-component system response regulator CP000675.2.gene1535. Protein 3e-37 41
SynRCC307_0250 YP_001226506.1 two-component system response regulator BAC0308 Protein 3e-36 41
SynRCC307_0250 YP_001226506.1 two-component system response regulator CP001485.1.gene721.p Protein 1e-33 41
SynRCC307_0250 YP_001226506.1 two-component system response regulator CP004022.1.gene3215. Protein 7e-34 41
SynRCC307_0250 YP_001226506.1 two-component system response regulator HE999704.1.gene1528. Protein 3e-30 41
SynRCC307_0250 YP_001226506.1 two-component system response regulator CP000034.1.gene3834. Protein 9e-29 41
SynRCC307_0250 YP_001226506.1 two-component system response regulator CP001138.1.gene4273. Protein 4e-29 41
SynRCC307_0250 YP_001226506.1 two-component system response regulator BAC0533 Protein 1e-29 41
SynRCC307_0250 YP_001226506.1 two-component system response regulator NC_002695.1.915041.p Protein 9e-29 41
SynRCC307_0250 YP_001226506.1 two-component system response regulator CP000647.1.gene4257. Protein 1e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SynRCC307_0250 YP_001226506.1 two-component system response regulator VFG1390 Protein 2e-39 44
SynRCC307_0250 YP_001226506.1 two-component system response regulator VFG1389 Protein 3e-32 43
SynRCC307_0250 YP_001226506.1 two-component system response regulator VFG0596 Protein 1e-31 42