|
Name : rpmJ (CMM_0025) Accession : YP_001220764.1 Strain : Clavibacter michiganensis NCPPB 382 Genome accession: NC_009480 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L36 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0257 EC number : - Position : 29995 - 30117 bp Length : 123 bp Strand : - Note : rpmJ2; smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound DNA sequence : ATGAAGGTGCGCAACTCGATCAAGGCCCTGAAGAAGCTCCCCGGCGCGCAGGTCGTGCGCCGTCGCGGCCGCGTCTTCGT CATCAACAAGCAGAATCCGCGGAACAAGGCGCGGCAGGGCTGA Protein sequence : MKVRNSIKALKKLPGAQVVRRRGRVFVINKQNPRNKARQG |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmJ | YP_001800879.1 | 50S ribosomal protein L36 | Not tested | Not named | Protein | 5e-08 | 70 |
