Gene Information

Name : VC0395_A1406 (VC0395_A1406)
Accession : YP_001217349.1
Strain :
Genome accession: NC_009457
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 1505734 - 1505964 bp
Length : 231 bp
Strand : -
Note : identified by match to protein family HMM PF05930

DNA sequence :
TTGCAACTAACCAACCTGAGAGGTGTGAATATGCCAGAGAACAACATTCGTTTGATCCGCTTTCGAGAAGTGCTAACTAT
GACTGGTTTGTCACGCTCTAGTTTGTACCGATTTATTGAAGAAAACCAATTCCCGCCCCAAGTTCAACTGGGTGGTCGTG
CTGTAGCTTGGGTAGAAGGCGAGGTGCAGGAGTGGATTGCTCAACGGATCACCAATCGTCGAATGGATTAG

Protein sequence :
MQLTNLRGVNMPENNIRLIRFREVLTMTGLSRSSLYRFIEENQFPPQVQLGGRAVAWVEGEVQEWIAQRITNRRMD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 2e-30 100
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 2e-30 100
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 5e-29 97
VC0497 NP_230151.1 transcriptional regulator Not tested VSP-2 Protein 3e-13 50
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 2e-11 45
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 3e-11 45
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 3e-11 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VC0395_A1406 YP_001217349.1 transcriptional regulator VFG1141 Protein 4e-31 100
VC0395_A1406 YP_001217349.1 transcriptional regulator VFG1118 Protein 9e-12 45