Gene Information

Name : VC0395_A1382 (VC0395_A1382)
Accession : YP_001217325.1
Strain :
Genome accession: NC_009457
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 1488904 - 1489110 bp
Length : 207 bp
Strand : -
Note : identified by match to protein family HMM PF05930

DNA sequence : 
ATGGGACAACAAGACATAGGAGAACATCCCATGAGATTTCTGAAACTAAAAGAAGTAATGGAAAAGACCGCACTAAGCCG
TTCAGCAATTTACCGAAAAATGAATGATGGCGAGTTTCCACAGTCGGTGAGCTTGGGAGAAAGGGCTATTGCCTGGGTGG
AAAGCGAAGTGGATGAGTGGATGGACTTTTGTCTTAAACAGCGATGA

Protein sequence : 
MGQQDIGEHPMRFLKLKEVMEKTALSRSAIYRKMNDGEFPQSVSLGERAIAWVESEVDEWMDFCLKQR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 2e-27 100
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 2e-27 100
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 2e-27 100
VC0497 NP_230151.1 transcriptional regulator Not tested VSP-2 Protein 4e-13 58
PMI2608 YP_002152324.1 prophage regulatory protein Not tested Not named Protein 1e-08 49
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 2e-09 46
unnamed CAA21398.1 - Not tested HPI Protein 3e-09 46
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 1e-11 45
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 3e-11 45
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 3e-11 45
ORF C109 AAN62202.1 phage-related protein Not tested PAGI-2(C) Protein 2e-08 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VC0395_A1382 YP_001217325.1 transcriptional regulator VFG1118 Protein 7e-28 100
VC0395_A1382 YP_001217325.1 transcriptional regulator VFG1141 Protein 9e-12 45