Gene Information

Name : DehaBAV1_0937 (DehaBAV1_0937)
Accession : YP_001214395.1
Strain : Dehalococcoides sp. BAV1
Genome accession: NC_009455
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 922326 - 923009 bp
Length : 684 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGCCCAAGAAAATACTGATAGCTGATGATGAAAAAAGGATAGCGGAAATCCTGCAAGCCTATTTGGAACGTGAAGGCTT
CAGGGTGATAGCTACTTATGACGGCAAGACAGCCTTAGCCAAATTTCACGAAGAAAACCCTGACCTGATAATACTTGACC
TGATGCTGCCTGAAATATCCGGCTGGGATGTCTGCCGCGAAATCCGCAAGGAAAGCCGTGTACCTATAATAATGCTTACC
GCCCGTGACGAACTCACCGACAAGCTTATAGGACTGGAAATTGGGGCGGATGATTATATGACCAAGCCCTTTGAATCCAA
GGAACTGGTAGCCCGCGTCAAAGTCCAGCTCAGACGGTCTGAATACCCCCCCAGCCCTGATTCAGCACTGGTTATTGACC
AACTGGAGATAGATCAGGAACGGCGTCTGGTCAAGATTGATGGCAAAACTGTAGACCTGACCGCCACCGAATTTGATATA
TTGATAAGCTTGGCCGTAAGTCCGGGTCGGGTTTTTTCCCGTATGCAGATATTGGACAAGCTGGGCGAAGCTTACGAAGG
ATATGAACGCACCATAGACAGCCATATTAAAAATCTACGAAAAAAAATAGAGCCTAACCTCGAATCCCCTACCTATATCC
TGACCGTACACGGGGTGGGCTACAAGATGAAAGACAGAGGATAA

Protein sequence :
MPKKILIADDEKRIAEILQAYLEREGFRVIATYDGKTALAKFHEENPDLIILDLMLPEISGWDVCREIRKESRVPIIMLT
ARDELTDKLIGLEIGADDYMTKPFESKELVARVKVQLRRSEYPPSPDSALVIDQLEIDQERRLVKIDGKTVDLTATEFDI
LISLAVSPGRVFSRMQILDKLGEAYEGYERTIDSHIKNLRKKIEPNLESPTYILTVHGVGYKMKDRG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-34 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator NC_012469.1.7685629. Protein 4e-44 48
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator AE000516.2.gene3505. Protein 7e-36 46
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator HE999704.1.gene2815. Protein 9e-40 45
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator AM180355.1.gene1830. Protein 1e-36 44
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 4e-35 44
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 5e-38 44
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator CP001918.1.gene3444. Protein 1e-39 44
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator BAC0039 Protein 3e-40 44
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator CP000034.1.gene2186. Protein 3e-40 44
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator NC_002695.1.916589.p Protein 2e-40 44
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator BAC0596 Protein 1e-40 44
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator CP000647.1.gene2531. Protein 8e-40 44
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator CP001138.1.gene2239. Protein 1e-40 44
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 7e-32 43
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 6e-38 43
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-38 43
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-38 43
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-39 43
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 8e-39 43
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 8e-39 43
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 8e-39 43
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 7e-39 43
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 8e-39 43
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 8e-39 43
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 8e-39 43
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 8e-39 43
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-39 43
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator CP004022.1.gene1676. Protein 2e-36 43
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 2e-36 42
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator CP000675.2.gene1535. Protein 2e-41 42
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-36 42
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-36 42
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator AE015929.1.gene1106. Protein 2e-27 41
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator EU250284.1.orf4.gene Protein 5e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator VFG1563 Protein 7e-35 42
DehaBAV1_0937 YP_001214395.1 two component transcriptional regulator VFG1702 Protein 9e-36 42