Gene Information

Name : DehaBAV1_0235 (DehaBAV1_0235)
Accession : YP_001213702.1
Strain : Dehalococcoides sp. BAV1
Genome accession: NC_009455
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 240143 - 240835 bp
Length : 693 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGCCTGAGCATAAAATATTGGTAGTTGAAGATGATGCCACTCTGCGGGAACTTTTGTGTTATAACCTTGCCAAAGAAGG
GTATCAGCTGGAATGTGCTGAAGACGGGCTGAAGGCACTTAGTGTTTACCGCCTGTTTAAGCCGGCACTGGTTATACTGG
ATGTTATGATACCGGGTATAGACGGCTTTGAACTCTGCCGCCTTATCCGCGCCGAGAGCAGTGTTCCCATACTTATGCTG
ACTGCCCGTTCAAGTGAGGCAGACAAAGTAAACGGGCTGGAAGCGGGGGCGGATGATTATCTATCCAAACCCTTTGGCAT
GAAGGAACTGCTGGCCAGAATGAGGGCTCTCCTTCGCCGCAGCCAGATGTTGAACTCTCAGGCAGATATAGCAGGCGGGC
TGAAGATAGGCGATTTGGAGATATTTATTGAACGCCATCTGGTAATACGGAACGGAGTTGCTCTGGATTTTTCCCCGAAA
GAATTTGACCTGTTTAGCTTTTTAGTGCAGAACCGCTATCGGGTTTTCAGCCGGGAACAACTGCTGGAAAAGGTCTGGGG
TTATGACTATCCCGGCGGTACCCGTACGGTGGATGTGCATATAAGCTGGCTTCGCCAGAAGATAGAGGTTGATCCCTCCA
AACCCCGCCACCTGATAACTGTCAGGGGAACCGGCTACAAGTTTGAGGAGTAG

Protein sequence :
MPEHKILVVEDDATLRELLCYNLAKEGYQLECAEDGLKALSVYRLFKPALVILDVMIPGIDGFELCRLIRAESSVPILML
TARSSEADKVNGLEAGADDYLSKPFGMKELLARMRALLRRSQMLNSQADIAGGLKIGDLEIFIERHLVIRNGVALDFSPK
EFDLFSFLVQNRYRVFSREQLLEKVWGYDYPGGTRTVDVHISWLRQKIEVDPSKPRHLITVRGTGYKFEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-30 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-41 48
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-43 46
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-43 46
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-43 46
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-43 46
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-43 46
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-43 46
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-43 46
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-43 46
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-43 46
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator AE000516.2.gene3505. Protein 6e-46 46
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-43 45
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator HE999704.1.gene2815. Protein 6e-43 45
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator AE016830.1.gene1681. Protein 1e-41 43
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator NC_012469.1.7686381. Protein 4e-37 43
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-33 42
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator AE015929.1.gene1106. Protein 3e-25 41
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator VFG1390 Protein 2e-34 44
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator VFG1389 Protein 4e-28 44
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator VFG1563 Protein 2e-30 42
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator VFG1702 Protein 2e-30 42
DehaBAV1_0235 YP_001213702.1 two component transcriptional regulator VFG1386 Protein 2e-30 42