|
Name : BRADO6209 (BRADO6209) Accession : YP_001208071.1 Strain : Bradyrhizobium sp. ORS278 Genome accession: NC_009445 Putative virulence/resistance : Virulence Product : prophage CP4-57 regulator Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 6446753 - 6446968 bp Length : 216 bp Strand : + Note : Evidence 3 : Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; PubMedId : 7511582; Product type pr : regulator DNA sequence : ATGCGCGAACCAGATCGTATCATCCGCTTGAGAACCGTCCTCGCCAGGACCGGACTGTCTCGATCTACCATCTACCGCAA GATCGCCGAAGGCACGTTCCCGGCCCCGCTCAAAATCAGCACCAACGGCTCGGGCTGGCACGACTCCGAAATCAACAGCT GGATAGCGGATCCAGTTGGATGGCGTCCGCGTCGCGACCTCGATGAGGTCCGGTGA Protein sequence : MREPDRIIRLRTVLARTGLSRSTIYRKIAEGTFPAPLKISTNGSGWHDSEINSWIADPVGWRPRRDLDEVR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 3e-09 | 43 |
| unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 1e-07 | 42 |
| unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 1e-07 | 42 |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-09 | 42 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-09 | 42 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| BRADO6209 | YP_001208071.1 | prophage CP4-57 regulator | VFG1141 | Protein | 1e-09 | 42 |
