
| Name : fliQ (BRADO5026) Accession : YP_001206940.1 Strain : Bradyrhizobium sp. ORS278 Genome accession: NC_009445 Putative virulence/resistance : Virulence Product : flagellar biosynthesis protein FliQ Function : - COG functional category : N : Cell motility COG ID : COG1987 EC number : - Position : 5216146 - 5216409 bp Length : 264 bp Strand : - Note : FliQ, with proteins FliP and FliR, forms the core of the central channel in the flagella export apparatus; Bradyrhizobium have one thick flagellum and several thin flagella; the protein in this cluster is associated with the thick flagellum DNA sequence : ATGACCGGAGCTGAAACGCTCGACGTCGCGCGCGATGCGATCTGGACGATCGTGATCGTCTCCTCTCCCTTGATGGTGGT CGGTCTGGTCGTCGGCGTGGTCGTGTCGTTGTTCCAGGCGCTGACGCAGATCCAGGAGCAGACGCTGGTGTTCGTGCCCA AGATCATCGCGATCTTCGTCACGCTGCTGTTGGGGCTGCCGTTCATGGCCGATGCGCTGCATCAGCACATGATGCGGATC TCGTCGCGAATCATCGGCGGATGA Protein sequence : MTGAETLDVARDAIWTIVIVSSPLMVVGLVVGVVVSLFQALTQIQEQTLVFVPKIIAIFVTLLLGLPFMADALHQHMMRI SSRIIGG | 
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity | 
| hrcS | ABA47280.1 | HrcS | Virulence | S-PAI | Protein | 5.2 | 43 | 
| lscS | AAO18039.1 | LscS | Virulence | TTSS locus | Protein | 5e-04 | 42 | 
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity | 
| fliQ | YP_001206940.1 | flagellar biosynthesis protein FliQ | VFG0395 | Protein | 9e-05 | 42 | 
 
 
  