Gene Information

Name : BRADO0293 (BRADO0293)
Accession : YP_001202501.1
Strain : Bradyrhizobium sp. ORS278
Genome accession: NC_009445
Putative virulence/resistance : Unknown
Product : IS66 Orf2 like
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 306228 - 306578 bp
Length : 351 bp
Strand : +
Note : Evidence 4 : Homologs of previously reported genes of unknown function

DNA sequence :
ATGACGATCCCGATCCCCTCCGGCACCCAGGTCTGGCTGGCGACCGGGCACACGGATATGCGCAAGGGCTTCGACGGTCT
GGCGCTGCTGGTCCAAGAGACGCTGAAGCGCGATCCGCATGGCGGCCATCTGTTCGTGTTCCGCGGCCGCAGCGGCAGCC
TGATCAAGGTGCTGTGGCACGACGGCCAGGGCATGTGCCTGTTCGCTAAGCGGCTGGAGCGTGGCCGCTTCATCTGGCCA
CAGGCTGTGGACGGAGCGTTGACAATCACGCCGGCGCAACTCGGCTATCTGCTCGAAGGCATCGATTGGCGGCATCCGCA
GCGGACGTGGCGGCCGGAAGCTGTTGGTTGA

Protein sequence :
MTIPIPSGTQVWLATGHTDMRKGFDGLALLVQETLKRDPHGGHLFVFRGRSGSLIKVLWHDGQGMCLFAKRLERGRFIWP
QAVDGALTITPAQLGYLLEGIDWRHPQRTWRPEAVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 8e-32 66
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 8e-32 66
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-31 65
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-31 65
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-31 65
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-31 65
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-31 65
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-31 65
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-31 65
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-31 65
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-30 64
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-30 64
unnamed AAL08461.1 unknown Not tested SRL Protein 4e-31 64
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-24 63
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 8e-33 63
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 8e-33 63
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-31 62
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-31 62
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-32 62
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 1e-25 55
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-29 55
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-29 55
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-29 54
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-28 53
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-28 53

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BRADO0293 YP_001202501.1 IS66 Orf2 like VFG1698 Protein 2e-32 66
BRADO0293 YP_001202501.1 IS66 Orf2 like VFG1709 Protein 1e-31 65
BRADO0293 YP_001202501.1 IS66 Orf2 like VFG0792 Protein 1e-31 65
BRADO0293 YP_001202501.1 IS66 Orf2 like VFG1052 Protein 2e-31 64
BRADO0293 YP_001202501.1 IS66 Orf2 like VFG1517 Protein 6e-25 63
BRADO0293 YP_001202501.1 IS66 Orf2 like VFG1665 Protein 8e-33 62
BRADO0293 YP_001202501.1 IS66 Orf2 like VFG1737 Protein 7e-30 54