Gene Information

Name : phoB (BRADO1679)
Accession : YP_001203793.1
Strain : Bradyrhizobium sp. ORS278
Genome accession: NC_009445
Putative virulence/resistance : Virulence
Product : two-component regulatory system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1795715 - 1796422 bp
Length : 708 bp
Strand : +
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; Product type r : regulator

DNA sequence :
ATGGGCGCGCGAATTCTGGTGGTTGAGGACGAGGAGGCGCTGACGACGCTGCTGCGCTACAACCTCGAAGCCGAAGGCTA
CGAGGTCGAGACCGTGGCGCGCGGCGACGAGGCCGACACGCGGCTGAAGGAGCGCATTCCCGATCTGGTCGTGCTCGACT
GGATGCTGCCGGGCCTCTCAGGGATCGAGCTGTGCCGGCGGCTGCGGGCGCGGTCCGAGACCAAGCAGCTGCCGATCATC
ATGCTGACGGCGCGCGGCGAGGAGAGCGAGCGCGTGCGCGGTCTTGCGACCGGCGCCGATGACTACATCGTCAAGCCGTT
CTCGGTGCCGGAGCTCTTGGCGCGTGTGAAGGGCCTGCTGCGGCGCGCCAGCCCGGAGCGGCTGGCGACCGTGCTGTCCT
ATGGCGACATCGAGCTCGATCGCGAGAAGCGCCGCGTGGCGCGGTCGGGCCGGCCGATCGATCTCGGCCCGACCGAATAT
CGCCTGCTCGAGTTCTTCCTGGAGCATCCCGGCCGCGTGTTCAGCCGCGAGCAGCTGCTCGACAGCGTCTGGGGCCGCGA
CATCTATATCGACGAGCGCACGGTCGACGTCCACATCGGCCGGCTGCGCAAGCTGCTCAATCCCGGCCGCGAGCAGGATC
CGATCCGCACCGTCCGCGGCGCCGGCTATGCGCTCGACGACCGGTTCGCCAAGTCTGAGCAGGCCTGA

Protein sequence :
MGARILVVEDEEALTTLLRYNLEAEGYEVETVARGDEADTRLKERIPDLVVLDWMLPGLSGIELCRRLRARSETKQLPII
MLTARGEESERVRGLATGADDYIVKPFSVPELLARVKGLLRRASPERLATVLSYGDIELDREKRRVARSGRPIDLGPTEY
RLLEFFLEHPGRVFSREQLLDSVWGRDIYIDERTVDVHIGRLRKLLNPGREQDPIRTVRGAGYALDDRFAKSEQA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-35 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-35 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_001203793.1 two-component regulatory system response regulator AE000516.2.gene3505. Protein 1e-35 45
phoB YP_001203793.1 two-component regulatory system response regulator NC_010410.6002989.p0 Protein 7e-38 43
phoB YP_001203793.1 two-component regulatory system response regulator NC_010400.5986590.p0 Protein 3e-37 43
phoB YP_001203793.1 two-component regulatory system response regulator NC_011595.7057856.p0 Protein 7e-38 43
phoB YP_001203793.1 two-component regulatory system response regulator NC_002952.2859905.p0 Protein 5e-42 43
phoB YP_001203793.1 two-component regulatory system response regulator NC_002745.1124361.p0 Protein 7e-42 43
phoB YP_001203793.1 two-component regulatory system response regulator NC_009782.5559369.p0 Protein 7e-42 43
phoB YP_001203793.1 two-component regulatory system response regulator NC_002951.3237708.p0 Protein 7e-42 43
phoB YP_001203793.1 two-component regulatory system response regulator NC_002758.1121668.p0 Protein 7e-42 43
phoB YP_001203793.1 two-component regulatory system response regulator NC_009641.5332272.p0 Protein 7e-42 43
phoB YP_001203793.1 two-component regulatory system response regulator NC_013450.8614421.p0 Protein 7e-42 43
phoB YP_001203793.1 two-component regulatory system response regulator NC_007793.3914279.p0 Protein 7e-42 43
phoB YP_001203793.1 two-component regulatory system response regulator NC_003923.1003749.p0 Protein 8e-42 43
phoB YP_001203793.1 two-component regulatory system response regulator NC_007622.3794472.p0 Protein 5e-42 43
phoB YP_001203793.1 two-component regulatory system response regulator BAC0596 Protein 2e-34 43
phoB YP_001203793.1 two-component regulatory system response regulator BAC0039 Protein 1e-34 43
phoB YP_001203793.1 two-component regulatory system response regulator NC_002695.1.916589.p Protein 1e-34 43
phoB YP_001203793.1 two-component regulatory system response regulator CP001138.1.gene2239. Protein 2e-34 43
phoB YP_001203793.1 two-component regulatory system response regulator CP000034.1.gene2186. Protein 1e-34 43
phoB YP_001203793.1 two-component regulatory system response regulator CP001918.1.gene3444. Protein 1e-34 43
phoB YP_001203793.1 two-component regulatory system response regulator HE999704.1.gene1528. Protein 6e-31 42
phoB YP_001203793.1 two-component regulatory system response regulator CP000647.1.gene2531. Protein 1e-34 42
phoB YP_001203793.1 two-component regulatory system response regulator NC_002516.2.879194.p Protein 2e-32 41
phoB YP_001203793.1 two-component regulatory system response regulator HE999704.1.gene2815. Protein 4e-38 41
phoB YP_001203793.1 two-component regulatory system response regulator NC_008702.1.4607594. Protein 7e-37 41
phoB YP_001203793.1 two-component regulatory system response regulator CP004022.1.gene1676. Protein 3e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_001203793.1 two-component regulatory system response regulator VFG1390 Protein 4e-39 45
phoB YP_001203793.1 two-component regulatory system response regulator VFG1563 Protein 5e-35 43
phoB YP_001203793.1 two-component regulatory system response regulator VFG1702 Protein 1e-35 43
phoB YP_001203793.1 two-component regulatory system response regulator VFG1389 Protein 3e-30 42
phoB YP_001203793.1 two-component regulatory system response regulator VFG1386 Protein 4e-35 41