Gene Information

Name : Fjoh_3400 (Fjoh_3400)
Accession : YP_001195733.1
Strain : Flavobacterium johnsoniae UW101
Genome accession: NC_009441
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4063771 - 4064445 bp
Length : 675 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGAAGTTACTAATAGTCGAAGACGAACCAAATCTTTTATCGATTTTACGTAAAGGTTTTGCCGAAAATAACAACGAAGT
AAGTGTGGCTCTTGATGGTAAAACTGCCCTTGAGATGATTGACAATTATAACTTTGATGTTGTCGTTTTAGATGTTATGC
TGCCGGATATTAACGGAATAGAGATTTGCAGAAGACTTCGCGCCAGTAAAAACTTTGTGCCTATTTTACTTTTAACGGCT
TTAGGAACTTCAGAAAATATTGTAACAGGACTTAATTCCGGTGCCGATGATTATTTGGTAAAGCCTTTTAAATTTGGAGA
ACTTGATGCCCGCGTAAACGCCCTGCACAGAAGAGCACATCAGGAAACCGATAAAATTGACGTGATTACTATTGGCGATT
TAGAAATAAACGGACGTGCTAAAACCGTTAAAAGAGATGGAGAATCTATTATTTTAACAGCAAAAGAGTTTAAACTCCTG
TATTATTTAGGTAAAAATGCCGGAAGAATTGTTTCTCGCGATCAGATTTTAGATAATGTCTGGGACATTAATTTTGACAT
GAATACCAATGTTGTTGATGTTTATATTACCTATTTAAGAAAAAAAGTAGACAAGCCTTTTAAAACTAAACTAATTCATA
CCATGAAAGGTTTAGGTTACGTTATAAAGCCATAA

Protein sequence :
MKLLIVEDEPNLLSILRKGFAENNNEVSVALDGKTALEMIDNYNFDVVVLDVMLPDINGIEICRRLRASKNFVPILLLTA
LGTSENIVTGLNSGADDYLVKPFKFGELDARVNALHRRAHQETDKIDVITIGDLEINGRAKTVKRDGESIILTAKEFKLL
YYLGKNAGRIVSRDQILDNVWDINFDMNTNVVDVYITYLRKKVDKPFKTKLIHTMKGLGYVIKP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-38 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-38 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Fjoh_3400 YP_001195733.1 two component transcriptional regulator BAC0111 Protein 1e-41 46
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 9e-41 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 9e-41 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 9e-41 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 9e-41 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 9e-41 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 9e-41 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 9e-41 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator AE015929.1.gene1106. Protein 3e-35 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 9e-41 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator BAC0125 Protein 6e-42 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator BAC0197 Protein 6e-40 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-39 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-39 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-39 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-39 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-39 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-39 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-39 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-39 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-39 44
Fjoh_3400 YP_001195733.1 two component transcriptional regulator BAC0083 Protein 6e-38 43
Fjoh_3400 YP_001195733.1 two component transcriptional regulator BAC0347 Protein 8e-37 43
Fjoh_3400 YP_001195733.1 two component transcriptional regulator BAC0308 Protein 6e-36 43
Fjoh_3400 YP_001195733.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-39 43
Fjoh_3400 YP_001195733.1 two component transcriptional regulator BAC0638 Protein 1e-33 42
Fjoh_3400 YP_001195733.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Fjoh_3400 YP_001195733.1 two component transcriptional regulator VFG0596 Protein 1e-38 43