Gene Information

Name : Pmen_3087 (Pmen_3087)
Accession : YP_001188573.1
Strain : Pseudomonas mendocina ymp
Genome accession: NC_009439
Putative virulence/resistance : Resistance
Product : gentamicin 3'-N-acetyltransferase
Function : -
COG functional category : R : General function prediction only
COG ID : COG0456
EC number : 2.3.1.60
Position : 3411278 - 3411805 bp
Length : 528 bp
Strand : +
Note : PFAM: GCN5-related N-acetyltransferase

DNA sequence :
ATGCGCAGCCCAACCTGGCCACCAGTACCCTCCTCCTTCTACCTAGAGGTGATTGCCATGAAAGAAGCACAAGGTATCTC
GATCCAGACGCTAGGCAGCGAGCATGTCGATGTCATGCGCGCGATGCTGGGCATGTTCGGCGAGGCCTTCGGGGAGACGG
CGACCTACACCGCAGCGCAGCCCGACGATGCCTACCTGCAGAGGCTGCTGGCGAGCGATGCGTTCTTCGCCATTGCCGCA
TTGGCCGAGGGGCAGGTGGTCGGCGGGCTGGCGGCCTACCTGCTACCCAAGTTCGAGCAGGCGCGCGCGGAAATCTACAT
CTACGACCTGGCCGTTGCGCAGCCGCATCGGCGGCGCGGCATCGCGACGGCGATGATCGAGCAGTTGAAGCACATCGCAG
CGGCCAGAGGAGCCTACGTCATCTACGTGCAGGCAGACCATGGCGACGATCCCGCCATCGCGCTCTATACCAAGCTCGGC
ATCCGAGAGGATGTGCTGCATTTCGATATCCCGCTGGAGCGCGGCTAG

Protein sequence :
MRSPTWPPVPSSFYLEVIAMKEAQGISIQTLGSEHVDVMRAMLGMFGEAFGETATYTAAQPDDAYLQRLLASDAFFAIAA
LAEGQVVGGLAAYLLPKFEQARAEIYIYDLAVAQPHRRRGIATAMIEQLKHIAAARGAYVIYVQADHGDDPAIALYTKLG
IREDVLHFDIPLERG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
acc(3)Ic ACY75521.1 Aac(3) Ic Not tested Tn6060 Protein 1e-39 68
aacC1 AFV53117.1 aminoglycoside (3) acetyltransferase AacC1 or AacC-A1 or AAC(3)-Ia Not tested AbGRI2-1 Protein 3e-38 68
aacCA1 AGK36643.1 aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR26 Protein 3e-38 68
aacC1/aacCA1 ACN81021.1 aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR5 Protein 4e-38 68
aacC1/aacCA1 ACV89836.1 type A aminoglycoside-(3)-acetyltransferase AacC1 or AacC-A1 or AAC-(3)-Ia Not tested AbaR7 Protein 3e-38 68
aacC1/aacCA1 ACN81020.1 aminoglycoside-(3)-acetyltransferase AacC-A1 or AacC1 or AAC-(3)-Ia Not tested AbaR5 Protein 3e-38 68
aac3 CAJ77083.1 Aminoglycoside 3-acetyltransferase Not tested AbaR1 Protein 2e-38 68
aacC1/aacCA1 ACV89833.1 type A aminoglycoside-(3)-acetyltransferase AacC-A1 or AacC1 or AAC-(3)-Ia Not tested AbaR7 Protein 2e-38 68
aacC1 AFV53118.1 aminoglycoside (3) acetyltransferase AacC1 or AacC-A1 or AAC(3)-Ia Not tested AbGRI2-1 Protein 2e-38 68
aacC1 YP_005797146.1 aminoglycoside N(3')-acetyltransferase I Not tested AbaR4e Protein 3e-38 68
aacCA5 AAR21853.1 aminoglycoside (3) acetyltransferase; AacCA5 or AAC(3)-Ie Not tested SGI1 Protein 2e-34 55
aacCA5 AGF35061.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 2e-34 55
aacCA5 AGK06931.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 2e-34 55
aacCA5 AGK06968.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 2e-34 55
aacCA5 AGK07014.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 2e-34 55
aacCA5 AGK07072.1 aminoglycoside acetyltransferase Not tested SGI1 Protein 2e-34 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pmen_3087 YP_001188573.1 gentamicin 3'-N-acetyltransferase AF318077.1.gene3.p01 Protein 1e-38 68
Pmen_3087 YP_001188573.1 gentamicin 3'-N-acetyltransferase NC_010410.6002585.p0 Protein 9e-39 68
Pmen_3087 YP_001188573.1 gentamicin 3'-N-acetyltransferase NC_011586.7045205.p0 Protein 9e-39 68
Pmen_3087 YP_001188573.1 gentamicin 3'-N-acetyltransferase U04610.gene.p01 Protein 2e-38 66