|
Name : Pmen_1159 (Pmen_1159) Accession : YP_001186658.1 Strain : Pseudomonas mendocina ymp Genome accession: NC_009439 Putative virulence/resistance : Virulence Product : phage transcriptional regulator AlpA Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 1306575 - 1306763 bp Length : 189 bp Strand : + Note : PFAM: regulatory protein, MerR; Prophage CP4-57 regulatory DNA sequence : ATGAGGATCATCCGTCTGAAAGAAGTCACCCACCTAACTGGCCTTGCTAGGTCGACCGTCTATAAATATCTCGCAGAAGG GAAGTTCCCAAAATCTGTTTCGCTAGGCCATAGGTCAATCGGATTTCTCGAGAGCGAAATTCAAGAGTGGATTATGGCCC GTATCAAAGAGCGAGATATGGCGGGCTAG Protein sequence : MRIIRLKEVTHLTGLARSTVYKYLAEGKFPKSVSLGHRSIGFLESEIQEWIMARIKERDMAG |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 1e-12 | 57 |
| VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-10 | 49 |
| VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-10 | 49 |
| VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 2e-10 | 49 |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 6e-12 | 47 |
| unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 5e-10 | 46 |
| unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 3e-10 | 46 |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-12 | 46 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-12 | 46 |
| ORF SG104 | AAN62325.1 | phage-related protein | Not tested | PAGI-3(SG) | Protein | 2e-08 | 46 |
| PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 5e-08 | 45 |
| S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-04 | 43 |
| rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 1e-04 | 43 |
| SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-04 | 43 |
| unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 6e-05 | 43 |
| ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 2e-04 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Pmen_1159 | YP_001186658.1 | phage transcriptional regulator AlpA | VFG1118 | Protein | 6e-11 | 49 |
| Pmen_1159 | YP_001186658.1 | phage transcriptional regulator AlpA | VFG1141 | Protein | 1e-12 | 46 |
| Pmen_1159 | YP_001186658.1 | phage transcriptional regulator AlpA | VFG0651 | Protein | 5e-05 | 43 |
