Gene Information

Name : Pmen_1159 (Pmen_1159)
Accession : YP_001186658.1
Strain : Pseudomonas mendocina ymp
Genome accession: NC_009439
Putative virulence/resistance : Virulence
Product : phage transcriptional regulator AlpA
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 1306575 - 1306763 bp
Length : 189 bp
Strand : +
Note : PFAM: regulatory protein, MerR; Prophage CP4-57 regulatory

DNA sequence :
ATGAGGATCATCCGTCTGAAAGAAGTCACCCACCTAACTGGCCTTGCTAGGTCGACCGTCTATAAATATCTCGCAGAAGG
GAAGTTCCCAAAATCTGTTTCGCTAGGCCATAGGTCAATCGGATTTCTCGAGAGCGAAATTCAAGAGTGGATTATGGCCC
GTATCAAAGAGCGAGATATGGCGGGCTAG

Protein sequence :
MRIIRLKEVTHLTGLARSTVYKYLAEGKFPKSVSLGHRSIGFLESEIQEWIMARIKERDMAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VC0497 NP_230151.1 transcriptional regulator Not tested VSP-2 Protein 1e-12 57
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 1e-10 49
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 2e-10 49
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 2e-10 49
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 6e-12 47
unnamed CAA21398.1 - Not tested HPI Protein 5e-10 46
unnamed CAB46594.1 DNA-binding protein Not tested HPI Protein 3e-10 46
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 4e-12 46
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 4e-12 46
ORF SG104 AAN62325.1 phage-related protein Not tested PAGI-3(SG) Protein 2e-08 46
PMI2608 YP_002152324.1 prophage regulatory protein Not tested Not named Protein 5e-08 45
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 2e-04 43
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 1e-04 43
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 2e-04 43
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 6e-05 43
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 2e-04 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pmen_1159 YP_001186658.1 phage transcriptional regulator AlpA VFG1118 Protein 6e-11 49
Pmen_1159 YP_001186658.1 phage transcriptional regulator AlpA VFG1141 Protein 1e-12 46
Pmen_1159 YP_001186658.1 phage transcriptional regulator AlpA VFG0651 Protein 5e-05 43