Gene Information

Name : Sputcn32_0277 (Sputcn32_0277)
Accession : YP_001181809.1
Strain : Shewanella putrefaciens CN-32
Genome accession: NC_009438
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 294097 - 294408 bp
Length : 312 bp
Strand : -
Note : PFAM: transposase IS3/IS911 family protein; KEGG: vch:VCA0792 transposase OrfAB, subunit A

DNA sequence :
ATGAATAAAAGTAAACGTGCACGATATAGCGCTGCCATTAAGCTCGAAACCGCTCAATTAGTCGTTGATCAAGGCTATAC
ACAAGAAGCGGCCGCAAAAGCCATGAACGTGGGTAAATCGACGGTCAGTAAGTGGGTAACACAGCTTCAGGTTGAGCGCC
AAGGGCATGCTCCTAAAGCCTCACCAATGACACCAGAACAAATTGAAATCAGGGCACTTAAACGCGAAATTGAACGGATT
AATCTCGAGAAAGAAATCTTAAAAAAGGCTACAGCTCTATTGATGTCGGACTCGCTGAACAATTCTCGATAA

Protein sequence :
MNKSKRARYSAAIKLETAQLVVDQGYTQEAAAKAMNVGKSTVSKWVTQLQVERQGHAPKASPMTPEQIEIRALKREIERI
NLEKEILKKATALLMSDSLNNSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-27 68
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-27 68
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-27 68
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-27 68
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-27 68
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-27 68
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-27 68
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-27 68
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 3e-26 66
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-27 66
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-27 66
api80 CAF28554.1 putative transposase Not tested YAPI Protein 9e-22 61
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-24 57
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 7e-21 53
unnamed AAC31483.1 L0004 Not tested LEE Protein 7e-21 53
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 1e-20 53
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 1e-20 53
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 3e-22 53
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 4e-22 53
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 8e-21 50

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sputcn32_0277 YP_001181809.1 transposase IS3/IS911 family protein VFG1123 Protein 8e-28 68
Sputcn32_0277 YP_001181809.1 transposase IS3/IS911 family protein VFG1485 Protein 9e-28 66
Sputcn32_0277 YP_001181809.1 transposase IS3/IS911 family protein VFG1553 Protein 6e-25 57
Sputcn32_0277 YP_001181809.1 transposase IS3/IS911 family protein VFG0784 Protein 3e-21 53