Gene Information

Name : Csac_0418 (Csac_0418)
Accession : YP_001179248.1
Strain : Caldicellulosiruptor saccharolyticus DSM 8903
Genome accession: NC_009437
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 464941 - 465606 bp
Length : 666 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence : 
ATGGCAAATATCTTAGTTGTTGAGGACCAGCAAGATTTAAATCAAATAATTACAAGGTTTTTGAAAAATGAAGGATTTGA
AGTTATAAATTCATACACTGCAAAAGGTGCACTGAGTAAGTTAAATGAGGCTGACTTGATAATTCTTGATATTATGCTAC
CTGATATGGAAGGGTATGAAGTATTGAAAGAAGCCAGCAAAAAAGGTATTCCCACAATAATATTAACCTCCAAATCAGAA
GAATTTGACAAGTTAAAAGGCTTTGAACTCGGGGCAGAGGACTATATCACAAAACCATTTTCTATGCTTGAGCTGATTGC
ACGCGTAAAGGTTGTTTTGAGGAGAAGCAAGAATTTTGAAGAAAGCATAAAACTTTTAGATGGCAAGGTAGAGATTTTCC
CCAAGAGGTTTAAGGTAATAGTGGATGGTGAGGATGTGAACCTCACTCATAAAGAGTTTGAGCTTTTGCTTTTCTTGGCT
AAAAACAAAGATTTGGTAAAGTCAAGAGATGAGATACTTGAAAAGGTTTGGGGGTTTGATTTTATTGGTGAGACTCGAAC
TGTGGACGTTCATATAAAGCAGTTAAGAGAAAAACTAAAAGACTATAAGTTTTTAATAAAGACAGTTTGGGGTGTGGGCT
ATAAACTTTCGGAGGATAAAGAATGA

Protein sequence : 
MANILVVEDQQDLNQIITRFLKNEGFEVINSYTAKGALSKLNEADLIILDIMLPDMEGYEVLKEASKKGIPTIILTSKSE
EFDKLKGFELGAEDYITKPFSMLELIARVKVVLRRSKNFEESIKLLDGKVEIFPKRFKVIVDGEDVNLTHKEFELLLFLA
KNKDLVKSRDEILEKVWGFDFIGETRTVDVHIKQLREKLKDYKFLIKTVWGVGYKLSEDKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 7e-32 42
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-41 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-32 43
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-42 43
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-42 43
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-42 43
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-42 43
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-35 43
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-42 43
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-42 43
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-41 43
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-42 43
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 7e-42 43
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-42 43
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator HE999704.1.gene1202. Protein 5e-37 42
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 8e-38 42
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 8e-38 42
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 8e-38 42
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 8e-38 42
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 8e-38 42
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 8e-38 42
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 8e-38 42
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 8e-38 42
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-41 42
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-39 42
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 6e-42 41
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-35 41
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 1e-34 41
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-34 41
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-34 41
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 7e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Csac_0418 YP_001179248.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-28 41